orn Resolved · high auto-curated

H37Rv Rv2511 · MTBC0 mtbc0_002673 · 215 aa · 2850047–2850694 MTBC0 (+) · RefSeq NP_217027.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)oligoribonuclease
MTBC0 PGAP re-annotationoligoribonuclease
Revised (this work)Oligoribonuclease. Pfam: RNase_T (PF00929.32).
Functional category (TubercuList)intermediary metabolism and respiration

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 19 publications

19 TB publications mention this gene. 19 publication(s) discuss this gene (12 in a M. tuberculosis context, 5 in other mycobacteria — M. smegmatis (5)).

Most recent 5 of 19.
PublicationDate
Orn-mediated c-di-GMP regulates the CRISPR-Cas system to confer stress response in Mycobacterium tuberculosis. doi:10.1093/nar/gkag214 2026
NrnA is a 5'-3' exonuclease that processes short RNA substrates in vivo and in vitro. doi:10.1093/nar/gkac1091 2022
Structural investigation and gene deletion studies of mycobacterial oligoribonuclease reveal modulation of c-di-GMP-mediated phenotypes. doi:10.1016/j.ijbiomac.2022.11.029 2022
Three-dimensional structure of a mycobacterial oligoribonuclease reveals a unique C-terminal tail that stabilizes the homodimer. doi:10.1016/j.jbc.2022.102595 2022
Rapidly Correcting Frameshift Mutations in the Mycobacterium tuberculosis orn Gene Produce Reversible Ethambutol Resistance and Small-Colony-Variant Morphology. doi:10.1128/AAC.00213-20 2020

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

CRISPRi vulnerability

Vulnerability index -1.63 (95% CI -1.95 to -1.28). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionInvolved in RNA degradation: 3'-to-5' exoribonuclease specific for small oligoribonucleotides.
Mycobrowser EC 3.1.-.- · superseded EC numbering; the atlas uses the current class (3.1.15.-)

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb2539 · 99.5% identity
M. leprae ML0427c · 89.3% identity
M. marinum MMAR_3859 · 85.6% identity
M. smegmatis MSMEG_4724 · 79.9% identity
M. orygis RJtmp_002596 · 99.1% identity
M. abscessus MAB_1533c · 80.5% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WIU1 SwissProt · reviewed · Evidence at protein level
UniProt nameOligoribonuclease
EC (curated) EC 3.1.15.-
Curated function3'-to-5' exoribonuclease specific for small oligoribonucleotides.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category A RNA processing and modification
Preferred nameorn
eggNOG description3'-to-5' exoribonuclease specific for small oligoribonucleotides
Orthologous groupCOG1949
KEGG orthology K13288
KEGG pathways map03008
Gene Ontology (32) GO:0000175, GO:0003674, GO:0003824, GO:0004518, GO:0004527, GO:0004532, GO:0004540, GO:0006139, GO:0006725, GO:0006807, GO:0008150, GO:0008152 +20 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.33 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 84.1% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 12/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 62.6%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis) essential

DeJesus 2017 callES · essential
What the call meansessential: insertions absent across the whole ORF
TA sites (Himar1) 9 in the ORF — 7 in the essential state, 0 growth-defect, 2 non-essential, 0 growth-advantage. Saturation 0.333, mean read count 22. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
CaveatRead with some caution: only 9 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 9 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3)

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain

This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.

Hypomorph strainorn-tetOn18.1 (TetON promoter 18)
Baseline knockdown fitness3.277 median doublings (across 6 screen pool(s)) — fewer doublings = stronger growth defect on knockdown
Used in target deconvolutionyes (informs phenotypic-cluster / MOA assignment)

Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.

Mutant phenotypes (conditional Tn-seq, MtbTnDB)

Conditionlog2FCqEffect
altered fitness under Isoniazid (drug exposure) +4.680.0 disruption advantageous
altered fitness under Isoniazid (drug exposure) +2.170.013 disruption advantageous

Conditional fitness of transposon-disruption mutants across 2 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.

Proteomics (mass spectrometry) detected

MS detectiondetected in 14 of 16 independent MS datasets
Integrated abundance185.0 ppm · rank 884/3519 (74.9th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length215 aa
Molecular weight23.4 kDa
Theoretical pI4.53
GRAVY-0.091 (hydrophilic)
Aliphatic index94.0
Aromaticity0.056
Instability index51.0 (unstable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
RNase_TPF00929.32 4.5e-356–169 Exonuclease

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 92.1

PDB hitprobTM-scoreE-valueDescription
7wik-assembly2_D 1.00 0.98 3.6e-33 sig 7wik-assembly2_D Crystal structure of oligoribonuclease of Mycobacterium smegmatis mc2 155
7wik-assembly1_A 1.00 0.98 1.5e-31 sig 7wik-assembly1_A Crystal structure of oligoribonuclease of Mycobacterium smegmatis mc2 155
9f7m-assembly2_B 1.00 0.98 1.1e-29 sig 9f7m-assembly2_B Blastococcus Orn bound to pGG
9f7m-assembly3_C 1.00 0.96 3.7e-28 sig 9f7m-assembly3_C Blastococcus Orn bound to pGG
6n6i-assembly2_B 1.00 0.97 1.1e-22 sig 6n6i-assembly2_B Human REXO2 bound to pGG

Foldseek search of the AlphaFold DB model (mean pLDDT 92.1, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 2

Upstream (5' on genome)Rv2510c (- strand, 67 bp gap)
Downstream (3' on genome)hisT (+ strand, 49 bp gap)
Predicted operon orn · hisT

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2510c hyp hypothetical protein 633 633 ctx neighborhood:632
Rv2478c hyp hypothetical protein 505 481
Rv0054 ssb single-strand DNA-binding protein 453 426
Rv2444c rne ribonuclease E 588 267 textmining:462
Rv2191 hyp hypothetical protein 422 264
Rv3907c pcnA poly(A) polymerase PcnA 736 248 textmining:664
Rv1340 rphA ribonuclease PH 735 227 textmining:672
Rv2783c gpsI bifunctional guanosine pentaphosphate synthetase/polyribonucleotide nucleotidyltransferase 637 169 textmining:582
Rv1930c hyp hypothetical protein 481 153 textmining:413
Rv2837c nrnA bifunctional oligoribonuclease/PAP phosphatase NrnA 932 71 textmining:930
Rv2131c cysQ 3'(2'),5'-bisphosphate nucleotidase CysQ 895 41 textmining:895
Rv2752c rnj ribonuclease J 617 41 textmining:617
Rv2555c alaS alanine--tRNA ligase 544 41 textmining:545
Rv1641 infC initiation factor IF-3 516 41 textmining:516
Rv2407 rnz ribonuclease Z 410 41 textmining:411

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: oligoribonuclease
  • MTBC0 PGAP product: oligoribonuclease
  • Pfam (hmmscan --cut_ga): RNase_T PF00929.32 (E=5e-35)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217027.1)
  • Domains: Pfam-A via hmmscan --cut_ga — RNase_T (PF00929.32)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1949
  • Curated reference: UniProt P9WIU1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 92.1)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 15 functional partner(s)
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002673|Rv2511|orn
MQDELVWIDCEMTGLDLGSDKLIEIAALVTDADLNILGDGVDVVMHADDAALSGMIDVVAEMHSRSGLIDEVKASTVDLATAEAMVLDYINEHVKQPKTAPLAGNSIATDRAFIARDMPTLDSFLHYRMIDVSSIKELCRRWYPRIYFGQPPKGLTHRALADIHESIRELRFYRRTAFVPQPGPSTSEIAAVVAELSDGAGAQEETDSAEAPQSG