orn Resolved · high auto-curated
H37Rv Rv2511 · MTBC0 mtbc0_002673 ·
215 aa ·
2850047–2850694 MTBC0
(+) ·
RefSeq NP_217027.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | oligoribonuclease |
|---|---|
| MTBC0 PGAP re-annotation | oligoribonuclease |
| Revised (this work) | Oligoribonuclease. Pfam: RNase_T (PF00929.32). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 19 publications
19 TB publications mention this gene. 19 publication(s) discuss this gene (12 in a M. tuberculosis context, 5 in other mycobacteria — M. smegmatis (5)).
| Publication | Date |
|---|---|
| Orn-mediated c-di-GMP regulates the CRISPR-Cas system to confer stress response in Mycobacterium tuberculosis. doi:10.1093/nar/gkag214 | 2026 |
| NrnA is a 5'-3' exonuclease that processes short RNA substrates in vivo and in vitro. doi:10.1093/nar/gkac1091 | 2022 |
| Structural investigation and gene deletion studies of mycobacterial oligoribonuclease reveal modulation of c-di-GMP-mediated phenotypes. doi:10.1016/j.ijbiomac.2022.11.029 | 2022 |
| Three-dimensional structure of a mycobacterial oligoribonuclease reveals a unique C-terminal tail that stabilizes the homodimer. doi:10.1016/j.jbc.2022.102595 | 2022 |
| Rapidly Correcting Frameshift Mutations in the Mycobacterium tuberculosis orn Gene Produce Reversible Ethambutol Resistance and Small-Colony-Variant Morphology. doi:10.1128/AAC.00213-20 | 2020 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index -1.63 (95% CI -1.95 to -1.28). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in RNA degradation: 3'-to-5' exoribonuclease specific for small oligoribonucleotides. |
|---|---|
| Mycobrowser EC |
3.1.-.-
· superseded EC numbering; the atlas uses the current class (3.1.15.-)
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2539
· 99.5% identity |
|---|---|
| M. leprae |
ML0427c
· 89.3% identity |
| M. marinum |
MMAR_3859
· 85.6% identity |
| M. smegmatis |
MSMEG_4724
· 79.9% identity |
| M. orygis |
RJtmp_002596
· 99.1% identity |
| M. abscessus |
MAB_1533c
· 80.5% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WIU1
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Oligoribonuclease |
| EC (curated) |
EC 3.1.15.-
|
| Curated function | 3'-to-5' exoribonuclease specific for small oligoribonucleotides. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
A RNA processing and modification
|
|---|---|
| Preferred name | orn |
| eggNOG description | 3'-to-5' exoribonuclease specific for small oligoribonucleotides |
| Orthologous group | COG1949 |
| KEGG orthology |
K13288
|
| KEGG pathways |
map03008
|
| Gene Ontology (32) |
GO:0000175, GO:0003674, GO:0003824, GO:0004518, GO:0004527, GO:0004532, GO:0004540, GO:0006139, GO:0006725, GO:0006807, GO:0008150, GO:0008152 +20 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.33 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 84.1%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 12/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 62.6% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) essential
| DeJesus 2017 call | ES · essential |
|---|---|
| What the call means | essential: insertions absent across the whole ORF |
| TA sites (Himar1) | 9 in the ORF — 7 in the essential state, 0 growth-defect, 2 non-essential, 0 growth-advantage. Saturation 0.333, mean read count 22. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Read with some caution: only 9 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 9 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain
This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.
| Hypomorph strain | orn-tetOn18.1 (TetON promoter 18) |
|---|---|
| Baseline knockdown fitness | 3.277 median doublings (across 6 screen pool(s)) — fewer doublings = stronger growth defect on knockdown |
| Used in target deconvolution | yes (informs phenotypic-cluster / MOA assignment) |
Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.
Mutant phenotypes (conditional Tn-seq, MtbTnDB)
| Condition | log2FC | q | Effect |
|---|---|---|---|
| altered fitness under Isoniazid (drug exposure) | +4.68 | 0.0 | disruption advantageous |
| altered fitness under Isoniazid (drug exposure) | +2.17 | 0.013 | disruption advantageous |
Conditional fitness of transposon-disruption mutants across 2 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 14 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 185.0 ppm · rank 884/3519 (74.9th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 215 aa |
|---|---|
| Molecular weight | 23.4 kDa |
| Theoretical pI | 4.53 |
| GRAVY | -0.091 (hydrophilic) |
| Aliphatic index | 94.0 |
| Aromaticity | 0.056 |
| Instability index | 51.0 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
RNase_T | PF00929.32 | 4.5e-35 | 6–169 | Exonuclease |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 92.1
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
7wik-assembly2_D |
1.00 | 0.98 | 3.6e-33 sig | 7wik-assembly2_D Crystal structure of oligoribonuclease of Mycobacterium smegmatis mc2 155 |
7wik-assembly1_A |
1.00 | 0.98 | 1.5e-31 sig | 7wik-assembly1_A Crystal structure of oligoribonuclease of Mycobacterium smegmatis mc2 155 |
9f7m-assembly2_B |
1.00 | 0.98 | 1.1e-29 sig | 9f7m-assembly2_B Blastococcus Orn bound to pGG |
9f7m-assembly3_C |
1.00 | 0.96 | 3.7e-28 sig | 9f7m-assembly3_C Blastococcus Orn bound to pGG |
6n6i-assembly2_B |
1.00 | 0.97 | 1.1e-22 sig | 6n6i-assembly2_B Human REXO2 bound to pGG |
Foldseek search of the AlphaFold DB model (mean pLDDT 92.1, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | Rv2510c (- strand, 67 bp gap) |
|---|---|
| Downstream (3' on genome) | hisT (+ strand, 49 bp gap) |
| Predicted operon |
orn · hisT
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2510c hyp |
hypothetical protein | 633 | 633 ctx | neighborhood:632 |
Rv2478c hyp |
hypothetical protein | 505 | 481 | |
Rv0054 ssb |
single-strand DNA-binding protein | 453 | 426 | |
Rv2444c rne |
ribonuclease E | 588 | 267 | textmining:462 |
Rv2191 hyp |
hypothetical protein | 422 | 264 | |
Rv3907c pcnA |
poly(A) polymerase PcnA | 736 | 248 | textmining:664 |
Rv1340 rphA |
ribonuclease PH | 735 | 227 | textmining:672 |
Rv2783c gpsI |
bifunctional guanosine pentaphosphate synthetase/polyribonucleotide nucleotidyltransferase | 637 | 169 | textmining:582 |
Rv1930c hyp |
hypothetical protein | 481 | 153 | textmining:413 |
Rv2837c nrnA |
bifunctional oligoribonuclease/PAP phosphatase NrnA | 932 | 71 | textmining:930 |
Rv2131c cysQ |
3'(2'),5'-bisphosphate nucleotidase CysQ | 895 | 41 | textmining:895 |
Rv2752c rnj |
ribonuclease J | 617 | 41 | textmining:617 |
Rv2555c alaS |
alanine--tRNA ligase | 544 | 41 | textmining:545 |
Rv1641 infC |
initiation factor IF-3 | 516 | 41 | textmining:516 |
Rv2407 rnz |
ribonuclease Z | 410 | 41 | textmining:411 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: oligoribonuclease
- MTBC0 PGAP product: oligoribonuclease
- Pfam (hmmscan --cut_ga): RNase_T PF00929.32 (E=5e-35)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217027.1)
- Domains: Pfam-A via hmmscan --cut_ga — RNase_T (PF00929.32)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1949 - Curated reference: UniProt P9WIU1 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 92.1)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 15 functional partner(s)
- Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002673|Rv2511|orn MQDELVWIDCEMTGLDLGSDKLIEIAALVTDADLNILGDGVDVVMHADDAALSGMIDVVAEMHSRSGLIDEVKASTVDLATAEAMVLDYINEHVKQPKTAPLAGNSIATDRAFIARDMPTLDSFLHYRMIDVSSIKELCRRWYPRIYFGQPPKGLTHRALADIHESIRELRFYRRTAFVPQPGPSTSEIAAVVAELSDGAGAQEETDSAEAPQSG
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for orn? Email the maintainer — the message is pre-filled with this gene's details.