Rv2506 Family assigned · medium auto-curated

H37Rv Rv2506 · MTBC0 mtbc0_002668 · 215 aa · 2844602–2845249 MTBC0 (+) · RefSeq NP_217022.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand bkdB (Rv2496c) — family_assigned: 3-methyl-2-oxobutanoate dehydrogenase subunit beta bkdB bkdA (Rv2497c) — family_assigned: pyruvate dehydrogenase (acetyl-transferring) E1 component su bkdA citE (Rv2498c) — family_assigned: citrate (pro-3S)-lyase subunit beta Rv2499c (Rv2499c) — family_assigned: MaoC family dehydratase fadE19 (Rv2500c) — family_assigned: acyl-CoA dehydrogenase family protein fadE19 accA1 (Rv2501c) — family_assigned: acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alph accA1 accD1 (Rv2502c) — family_assigned: acetyl-/propionyl-CoA carboxylase subunit beta accD1 scoB (Rv2503c) — family_assigned: succinyl-CoA--3-ketoacid CoA transferase subunit B scoA (Rv2504c) — family_assigned: succinyl-CoA--3-ketoacid CoA transferase subunit A fadD35 (Rv2505c) — family_assigned: AMP-binding protein fadD35 Rv2506 (Rv2506) — family_assigned: TetR/AcrR family transcriptional regulator Rv2507 (Rv2507) — family_assigned: MmpS family transport accessory protein Rv2508c (Rv2508c) — requalified: MFS transporter Rv2508c cmrA (Rv2509) — requalified: mycolate reductase Rv2510c (Rv2510c) — family_assigned: DUF853 domain-containing protein Rv2510c orn (Rv2511) — requalified: oligoribonuclease Rv2513 (Rv2513) — dark: hypothetical protein Rv2514c (Rv2514c) — family_assigned: DUF4411 family protein Rv2515c (Rv2515c) — family_assigned: XRE family transcriptional regulator Rv2515c Rv2516c (Rv2516c) — dark: hypothetical protein Rv2517c (Rv2517c) — dark: hypothetical protein 2 836 kb 2 840 kb 2 844 kb 2 848 kb 2 852 kb 2 856 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)TetR family transcriptional regulator
MTBC0 PGAP re-annotationTetR/AcrR family transcriptional regulator
Revised (this work)TetR/AcrR family transcriptional regulator. Pfam: TetR_N (PF00440.30), TetR_C_24 (PF17932.7).
Functional category (TubercuList)regulatory proteins

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 1 publication

1 TB publication mentions this gene. 1 publication(s) discuss this gene (1 in a M. tuberculosis context, 1 in other mycobacteria — M. smegmatis (1)).

PublicationDate
bkaR is a TetR-type repressor that controls an operon associated with branched-chain keto-acid metabolism in Mycobacteria. doi:10.1111/1574-6968.12196 2013

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

CRISPRi vulnerability

Vulnerability index 0.59 (95% CI -1.28 to 3.60). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionInvolved in transcriptional mechanism.

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb2534 · 99.5% identity
M. marinum MMAR_3853 · 81.3% identity
M. smegmatis MSMEG_4718 · 70.1% identity
M. orygis RJtmp_002591 · 99.5% identity
M. abscessus MAB_4541 · 60.9% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt O06169 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable transcriptional regulatory protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptionTranscriptional regulator
Orthologous groupCOG1309

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.189 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Actinomycetia

Genus-wide presence (~53 non-MTBC Mycobacterium) present in 52/53 (98%) · mean identity 83.3% · 4/4 closest MTBAP relatives
conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 7/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 55.9%
detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis) cholesterol-required

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 10 in the ORF — 0 in the essential state, 0 growth-defect, 10 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 145.6. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
Cholesterol catabolismrequired for growth on cholesterol (Griffin 2011)

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype

Conditionlog2FCqEffect
fitness on cholesterol (vs glycerol) (carbon source) -2.910.03 required
fitness in mouse infection (in vivo) -1.970.032 required
fitness in mouse infection (in vivo) +1.370.03 disruption advantageous

Conditional fitness of transposon-disruption mutants across 3 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.

Proteomics (mass spectrometry) detected

MS detectiondetected in 10 of 16 independent MS datasets
Integrated abundance9.82 ppm · rank 2691/3519 (23.6th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length215 aa
Molecular weight23.2 kDa
Theoretical pI9.86
GRAVY-0.022 (hydrophilic)
Aliphatic index101.9
Aromaticity0.047
Instability index29.9 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
TetR_NPF00440.30 3.5e-1830–76 Bacterial regulatory proteins, tetR family
TetR_C_24PF17932.7 7.8e-08100–180 Tetracyclin repressor-like, C-terminal domain

Experimental structures (Protein Data Bank) 2 solved

PDBMethodResolutionCoverage
6yj2 X-ray diffraction 2.0 Å 100%
6yl2 X-ray diffraction 3.15 Å 91%

Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (2 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 90.6

PDB hitprobTM-scoreE-valueDescription
6yj2-assembly1_A 1.00 0.98 2.5e-22 sig 6yj2-assembly1_A Structural and DNA binding studies of the transcriptional repressor Rv2506 (BkaR) from Mycobacterium tuberculosis supports a role in L-Leucine catabolism
6yj2-assembly2_C 1.00 0.98 1.8e-21 sig 6yj2-assembly2_C Structural and DNA binding studies of the transcriptional repressor Rv2506 (BkaR) from Mycobacterium tuberculosis supports a role in L-Leucine catabolism
4g12-assembly1_A 1.00 0.98 7.0e-21 sig 4g12-assembly1_A Crystal structure of putative TetR family transcriptional regulator, Fad35R, from Mycobacterium tuberculosis
9b7y-assembly1_D 1.00 0.76 2.9e-07 sig 9b7y-assembly1_D Cryo-EM structure of TetR regulator Mce3R from Mycobacterium tuberculosis bound to a DNA oligonucleotide
4w97-assembly1_A 1.00 0.81 4.1e-06 sig 4w97-assembly1_A Structure of ketosteroid transcriptional regulator KstR2 of Mycobacterium tuberculosis

Foldseek search of the AlphaFold DB model (mean pLDDT 90.6, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon)

Upstream (5' on genome)fadD35 (- strand, 115 bp gap)
Downstream (3' on genome)Rv2507 (+ strand, 78 bp gap)

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE) transcription factor

Regulated by (3 TF) Rv0081 (activates) · Rv2034 (represses) · Rv2506 (activates)
Regulonthis transcription factor regulates 11 target gene(s)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: Rv2499c (oxidase regulatory-like protein), high confidence from genomic context alone (score 829 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2499c oxidase regulatory-like protein 870 829 ctx neighborhood:714 cooccurence:413
Rv0339c iniR transcriptional regulator 802 802 coexpression:802
Rv3055 TetR family transcriptional regulator 788 788 coexpression:788
Rv2501c accA1 acetyl/propionyl-CoA carboxylase subuit alpha 871 781 ctx neighborhood:714 textmining:436
Rv2498c citE citrate (pro-3S)-lyase subunit beta 918 776 ctx neighborhood:714 textmining:651
Rv2502c accD1 acetyl-/propionyl-CoA carboxylase subunit beta 884 761 ctx neighborhood:714 textmining:536
Rv0067c transcriptional regulator 761 761 coexpression:761
Rv2500c fadE19 acyl-CoA dehydrogenase FadE19 795 753 ctx neighborhood:714
Rv3060c GntR family transcriptional regulator 744 737 coexpression:736
Rv3840 transcriptional regulator 734 734 coexpression:734
Rv3855 ethR HTH-type transcriptional repressor EthR 801 732 coexpression:732
Rv0691c mftR mycofactocin biosynthesis transcriptional regulator MftR 739 732 coexpression:732
Rv0273c transcriptional regulator 730 730 coexpression:730
Rv1189 sigI ECF RNA polymerase sigma factor SigI 730 730 coexpression:730
Rv3183 higA3 transcriptional regulator 729 729 coexpression:729

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: TetR family transcriptional regulator
  • MTBC0 PGAP product: TetR/AcrR family transcriptional regulator
  • Pfam (hmmscan --cut_ga): TetR_N PF00440.30 (E=3e-18), TetR_C_24 PF17932.7 (E=8e-08)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217022.1)
  • Domains: Pfam-A via hmmscan --cut_ga — TetR_N (PF00440.30), TetR_C_24 (PF17932.7)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1309
  • Curated reference: UniProt O06169 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 90.6)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 47 functional partner(s); context anchor Rv2499c
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY); cholesterol requirement from Griffin et al. 2011 (doi:10.1371/journal.ppat.1002251)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002668|Rv2506|
MTASAPDGRPGQPEATNRRSQLKSDRRFQLLAAAERLFAERGFLAVRLEDIGAAAGVSGPAIYRHFPNKESLLVELLVGVSARLLAGARDVTTRSANLAAALDGLIEFHLDFALGEADLIRIQDRDLAHLPAVAERQVRKAQRQYVEVWVGVLRELNPGLAEADARLMAHAVFGLLNSTPHSMKAADSKPARTVRARAVLRAMTVAALSAADRCL