PPE42 Family assigned · medium auto-curated
H37Rv Rv2608 · MTBC0 - ·
580 aa ·
2935046–2936788 H37Rv
(+) ·
RefSeq YP_177893.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | PPE family protein PPE42 |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | PPE family protein PPE42. Pfam: PPE (PF00823.26), PE-PPE (PF08237.18). |
| Functional category (TubercuList) | PE/PPE |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
In the literature (TB corpus sweep) 10 publications
10 TB publications mention this gene. 10 publication(s) discuss this gene (10 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| PE/PPE proteins contribute to Mycobacterium tuberculosis drug resistance. doi:10.1038/s41467-026-72431-7 | 2026 |
| PE/PPE proteins contribute to Mycobacterium tuberculosis drug resistance. doi:10.1101/2025.09.24.678375 | 2025 |
| Enhanced serodiagnostic potential of a fusion molecule consisting of Rv1793, Rv2628 and a truncated Rv2608 of Mycobacterium tuberculosis. doi:10.1371/journal.pone.0258389 | 2021 |
| Balance between Protection and Pathogenic Response to Aerosol Challenge with Mycobacterium tuberculosis (Mtb) in Mice Vaccinated with TriFu64, a Fusion Consisting of Three Mtb Antigens. doi:10.3390/vaccines9050519 | 2021 |
| Prediction and analyses of HLA-II restricted Mycobacterium tuberculosis CD4+ T cell epitopes in the Chinese population. doi:10.1002/bab.2171 | 2022 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index 0.89 (95% CI -0.71 to 3.61). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Function unknown |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2640
· 99.8% identity |
|---|---|
| M. smegmatis |
MSMEG_4734
· 35.1% identity |
| M. orygis |
RJtmp_002700
· 99.8% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WHZ5
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Uncharacterized PPE family protein PPE42 |
| Curated function | Elicits a high humoral and a low T-cell response. Could be involved in directing the host toward development of a more humoral type of immune response. |
UniProt still lists this protein as Uncharacterized PPE family protein PPE42; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
N Cell motility
|
|---|---|
| eggNOG description | PFAM PE-PPE, C-terminal |
| Orthologous group | COG5651 |
| Gene Ontology (33) |
GO:0002682, GO:0002684, GO:0008150, GO:0009605, GO:0009607, GO:0035821, GO:0043207, GO:0044003, GO:0044403, GO:0044419, GO:0048518, GO:0048583 +21 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.498 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 5 synonymous, 6 missense, 1 nonsense, 0 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.10% of strains (148) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Mycobacterium
| M. canettii dN/dS (deep-divergence selection) |
1.069 (low power)
· 4 consensus substitution(s) low power (4 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 30/53 (57%) · mean identity 53.3%
· 4/4 closest MTBAP relatives conserved across the genus (present in 30/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria present across the genus Mycobacterium (NTM) but not detected in any non-Mycobacterium genome — a Mycobacterium-genus gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 33 in the ORF — 0 in the essential state, 0 growth-defect, 33 non-essential, 0 growth-advantage. Saturation 0.939, mean read count 164.225806452. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 6 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 0.84 ppm · rank 3305/3519 (6.1th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 580 aa |
|---|---|
| Molecular weight | 59.7 kDa |
| Theoretical pI | 4.44 |
| GRAVY | 0.258 (hydrophobic) |
| Aliphatic index | 99.2 |
| Aromaticity | 0.078 |
| Instability index | 35.1 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
PPE | PF00823.26 | 1.3e-62 | 2–165 | PPE family |
PE-PPE | PF08237.18 | 1.5e-84 | 300–525 | PE-PPE domain |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 87.9
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
5xfs-assembly1_B |
1.00 | 0.94 | 1.3e-12 sig | 5xfs-assembly1_B Crystal structure of PE8-PPE15 in complex with EspG5 from M. tuberculosis |
4w4l-assembly1_B |
1.00 | 0.86 | 7.0e-09 sig | 4w4l-assembly1_B Crystal structure of EspG5 in complex with PE25 and PPE41 from the ESX-5 type VII secretion system of M. tuberculosis |
6vj5-assembly1_B |
1.00 | 0.86 | 2.1e-08 sig | 6vj5-assembly1_B Structure of PE25-PPE41(A124L) in complex with EspG5 chaperone from the type VII (ESX-5) secretion system |
6uuj-assembly3_H |
1.00 | 0.85 | 5.1e-08 sig | 6uuj-assembly3_H Structure of PE5-PPE4-EspG3 complex from the type VII (ESX-3) secretion system, space group P212121 |
6uuj-assembly2_E |
1.00 | 0.86 | 1.0e-07 sig | 6uuj-assembly2_E Structure of PE5-PPE4-EspG3 complex from the type VII (ESX-3) secretion system, space group P212121 |
Foldseek search of the AlphaFold DB model (mean pLDDT 87.9, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | pdxH (+ strand, 173 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv2609c (- strand, 21 bp gap) |
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: Rv2209 (integral membrane protein), high confidence from genomic context alone (score 773 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2209 |
integral membrane protein | 772 | 773 ctx | cooccurence:770 |
Rv1004c |
membrane protein | 771 | 772 ctx | cooccurence:769 |
Rv1651c PE_PGRS30 |
PE-PGRS family protein PE_PGRS30 | 802 | 771 ctx | cooccurence:771 |
Rv1452c PE_PGRS28 |
PE-PGRS family protein PE_PGRS28 | 779 | 771 ctx | cooccurence:771 |
Rv0872c PE_PGRS15 |
PE-PGRS family protein PE_PGRS15 | 778 | 770 ctx | cooccurence:770 |
Rv2490c PE_PGRS43 |
PE-PGRS family protein PE_PGRS43 | 777 | 769 ctx | cooccurence:769 |
Rv2942 mmpL7 |
transmembrane transport protein MmpL7 | 769 | 769 ctx | cooccurence:768 |
Rv3879c espK |
ESX-1 secretion-associated protein EspK | 768 | 768 ctx | cooccurence:768 |
Rv2082 hyp |
hypothetical protein | 766 | 767 ctx | cooccurence:764 |
Rv0341 iniB |
isoniazid inducible protein IniB | 760 | 760 ctx | cooccurence:760 |
Rv2853 PE_PGRS48 |
PE-PGRS family protein PE_PGRS48 | 765 | 757 ctx | cooccurence:757 |
Rv2954c hyp |
hypothetical protein | 755 | 756 ctx | cooccurence:754 |
Rv0977 PE_PGRS16 |
PE-PGRS family protein PE_PGRS16 | 779 | 753 ctx | cooccurence:753 |
Rv3864 espE |
ESX-1 secretion-associated protein EspE | 814 | 752 ctx | cooccurence:751 |
Rv2819c csm5 |
CRISPR type III-associated RAMP protein Csm5 | 750 | 751 ctx | cooccurence:749 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): PPE family protein PPE42
- Pfam (hmmscan --cut_ga): PPE PF00823.26 (E=1e-62), PE-PPE PF08237.18 (E=2e-84)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177893.1)
- Domains: Pfam-A via hmmscan --cut_ga — PPE (PF00823.26), PE-PPE (PF08237.18)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG5651 - Curated reference: UniProt P9WHZ5 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 87.9)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
123 functional partner(s); context anchor
Rv2209 - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv2608|PPE42 MNFAVLPPEVNSARIFAGAGLGPMLAAASAWDGLAEELHAAAGSFASVTTGLAGDAWHGPASLAMTRAASPYVGWLNTAAGQAAQAAGQARLAASAFEATLAATVSPAMVAANRTRLASLVAANLLGQNAPAIAAAEAEYEQIWAQDVAAMFGYHSAASAVATQLAPIQEGLQQQLQNVLAQLASGNLGSGNVGVGNIGNDNIGNANIGFGNRGDANIGIGNIGDRNLGIGNTGNWNIGIGITGNGQIGFGKPANPDVLVVGNGGPGVTALVMGGTDSLLPLPNIPLLEYAARFITPVHPGYTATFLETPSQFFPFTGLNSLTYDVSVAQGVTNLHTAIMAQLAAGNEVVVFGTSQSATIATFEMRYLQSLPAHLRPGLDELSFTLTGNPNRPDGGILTRFGFSIPQLGFTLSGATPADAYPTVDYAFQYDGVNDFPKYPLNVFATANAIAGILFLHSGLIALPPDLASGVVQPVSSPDVLTTYILLPSQDLPLLVPLRAIPLLGNPLADLIQPDLRVLVELGYDRTAHQDVPSPFGLFPDVDWAEVAADLQQGAVQGVNDALSGLGLPPPWQPALPRLF
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for PPE42? Email the maintainer — the message is pre-filled with this gene's details.