bkdA Family assigned · medium auto-curated
H37Rv Rv2497c · MTBC0 mtbc0_002659 ·
367 aa ·
2833883–2834986 MTBC0
(-) ·
RefSeq NP_217013.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | 3-methyl-2-oxobutanoate dehydrogenase subunit alpha |
|---|---|
| MTBC0 PGAP re-annotation | pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha |
| Revised (this work) | Pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha. Pfam: E1_dh (PF00676.26), DXP_synthase_N (PF13292.12). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 1 publication
1 TB publication mentions this gene. 1 publication(s) discuss this gene (2 in a M. tuberculosis context, 1 in other mycobacteria — M. smegmatis (1)).
| Publication | Date |
|---|---|
| Proximity-dependent biotin identification links cholesterol catabolism with branched-chain amino acid degradation in Mycobacterium smegmatis. doi:10.1096/fj.202202018RR | 2023 |
| Purification and characterization of major antigens from a Mycobacterium bovis culture filtrate. doi:10.1128/iai.59.3.800-807.1991 | 1991 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index 0.96 (95% CI -0.98 to 4.10). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in energy metabolism. The branched-chain alpha-keto acid dehydrogenase complex catalyzes the overall conversion of branched chain alpha-keto acids to acyl-CoA and CO2. It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3). |
|---|---|
| Mycobrowser EC |
1.2.4.1, 1.2.4.4
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2525c
· 100.0% identity |
|---|---|
| M. marinum |
MMAR_3844
· 84.5% identity |
| M. smegmatis |
MSMEG_4712
· 73.1% identity |
| M. orygis |
RJtmp_002582
· 100.0% identity |
| M. abscessus |
MAB_4918c
· 45.1% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WIS3
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | 3-methyl-2-oxobutanoate dehydrogenase subunit alpha |
| EC (curated) |
EC 1.2.4.4
|
| Curated function | Component of the branched-chain alpha-keto dehydrogenase complex, which catalyzes the overall conversion of alpha-keto acids derived from the branched-chain amino-acids valine, leucine and isoleucine to acyl-CoA and CO(2). The complex contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3) (By similarity). The E1 subunit catalyzes the first step with the decarboxylation of the alpha-ketoacid forming an enzyme-product intermediate (By similarity). |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
C Energy production and conversion
|
|---|---|
| Preferred name | pdhA |
| eggNOG description | Dehydrogenase E1 component |
| Orthologous group | COG1071 |
| EC number |
EC 1.2.4.1, EC 1.2.4.4
|
| KEGG orthology |
K00161, K00166
|
| KEGG pathways |
map00010, map00020, map00280, map00620, map00640, map01100, map01110, map01120, map01130, map01200, map04066, map04922, map05230
|
| KEGG modules |
M00036, M00307
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.332 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 50/53 (94%) · mean identity 73.2%
· 4/4 closest MTBAP relatives conserved across the genus (present in 50/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 7/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 45.2% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 23 in the ORF — 0 in the essential state, 0 growth-defect, 23 non-essential, 0 growth-advantage. Saturation 0.783, mean read count 116.5. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 14 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 69.7 ppm · rank 1537/3519 (56.4th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 367 aa |
|---|---|
| Molecular weight | 40.6 kDa |
| Theoretical pI | 5.15 |
| GRAVY | -0.305 (hydrophilic) |
| Aliphatic index | 77.7 |
| Aromaticity | 0.082 |
| Instability index | 42.6 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
E1_dh | PF00676.26 | 6.9e-86 | 48–332 | Dehydrogenase E1 component |
DXP_synthase_N | PF13292.12 | 6.1e-06 | 148–208 | 1-deoxy-D-xylulose-5-phosphate synthase |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 95.3
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
1w85-assembly1_A |
1.00 | 0.93 | 8.6e-31 sig | 1w85-assembly1_A The crystal structure of pyruvate dehydrogenase E1 bound to the peripheral subunit binding domain of E2 |
3dva-assembly2_G |
1.00 | 0.94 | 1.5e-30 sig | 3dva-assembly2_G Snapshots of catalysis in the E1 subunit of the pyruvate dehydrogenase multi-enzyme complex |
1umc-assembly1_C |
1.00 | 0.92 | 2.9e-30 sig | 1umc-assembly1_C branched-chain 2-oxo acid dehydrogenase (E1) from Thermus thermophilus HB8 with 4-methylpentanoate |
3dva-assembly2_E |
1.00 | 0.91 | 1.0e-29 sig | 3dva-assembly2_E Snapshots of catalysis in the E1 subunit of the pyruvate dehydrogenase multi-enzyme complex |
1x7z-assembly1_A-2 |
1.00 | 0.89 | 7.7e-29 sig | 1x7z-assembly1_A-2 Crystal structure of the human mitochondrial branched-chain alpha-ketoacid dehydrogenase |
Foldseek search of the AlphaFold DB model (mean pLDDT 95.3, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Catalytic-site verification (M-CSA on the structural model) fold only
| M-CSA entry | 106 · EC 1.2.4.1 |
|---|---|
| Catalytic residues | 2/5 identical (4/5 aligned) |
| Verdict | FOLD-ONLY (2/5 identical although 4/5 aligned: catalytic residues SUBSTITUTED) -> same fold, active site NOT retained |
Catalytic residues of the matched M-CSA reference enzyme mapped onto the structural model by alignment. An active-site-conserved verdict upgrades a mere fold match to a likely active enzyme; fold-only flags a shared fold whose catalytic machinery is not retained (a guard against over-calling).
Genomic context (neighbours & predicted operon) operon of 3
| Upstream (5' on genome) | bkdB (- strand, 10 bp gap) |
|---|---|
| Downstream (3' on genome) | citE (- strand, 258 bp gap) |
| Predicted operon |
bkdC · bkdB · bkdA
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (1 TF) |
Rv1816 (activates)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: bkdC (branched-chain keto acid dehydrogenase E2 component), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2495c bkdC exp |
branched-chain keto acid dehydrogenase E2 component | 999 | 1000 ctx | neighborhood:879 cooccurence:773 coexpression:925 experimental:415 database:957 textmining:720 |
Rv2496c bkdB exp |
3-methyl-2-oxobutanoate dehydrogenase subunit beta | 999 | 1000 ctx | neighborhood:879 fusion:900 cooccurence:774 coexpression:942 experimental:829 database:965 textmining:682 |
Rv0462 lpdC exp |
dihydrolipoamide dehydrogenase | 989 | 985 | coexpression:500 database:956 |
Rv2215 dlaT exp |
pyruvate dehydrogenase E2 component dihydrolipoamide acyltransferase | 981 | 974 ctx | cooccurence:746 coexpression:603 experimental:415 database:591 |
Rv1248c kgd exp |
multifunctional 2-oxoglutarate dehydrogenase E1 component /2-oxoglutarate dehydrogenase dihydrolipoyllysine-residue succinyltransferase | 975 | 962 | coexpression:600 experimental:415 database:844 |
Rv2332 mez exp |
malate oxidoreductase | 932 | 907 | database:900 |
Rv1734c hyp exp |
hypothetical protein | 930 | 907 | coexpression:598 experimental:415 database:591 |
Rv1617 pykA exp |
pyruvate kinase | 923 | 907 | database:900 |
Rv2967c pca exp |
pyruvate carboxylase | 910 | 906 | database:900 |
Rv2455c korA exp |
2-oxoglutarate oxidoreductase subunit KorA | 949 | 905 | database:900 textmining:497 |
Rv2241 aceE exp |
pyruvate dehydrogenase E1 component | 970 | 904 | database:900 textmining:703 |
Rv1127c ppdK exp |
pyruvate, phosphate dikinase PpdK | 911 | 904 | database:900 |
Rv0694 mftD exp |
mycofactocin system heme/flavin oxidoreductase MftD | 906 | 903 | database:900 |
Rv1872c lldD2 exp |
L-lactate dehydrogenase | 906 | 903 | database:900 |
Rv2454c korB exp |
2-oxoglutarate oxidoreductase subunit KorB | 926 | 902 | database:900 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: 3-methyl-2-oxobutanoate dehydrogenase subunit alpha
- MTBC0 PGAP product: pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha
- Pfam (hmmscan --cut_ga): E1_dh PF00676.26 (E=7e-86), DXP_synthase_N PF13292.12 (E=6e-06)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217013.1)
- Domains: Pfam-A via hmmscan --cut_ga — E1_dh (PF00676.26), DXP_synthase_N (PF13292.12)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1071 - Curated reference: UniProt P9WIS3 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 95.3)
- Catalytic-site verification: M-CSA (Ribeiro et al. 2018, doi:10.1093/nar/gkx1012), entry 106; catalytic residues aligned onto the structural model
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
69 functional partner(s); context anchor
bkdC - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002659|Rv2497c|bkdA MGEGSRRPSGMLMSVDLEPVQLVGPDGTPTAERRYHRDLPEETLRWLYEMMVVTRELDTEFVNLQRQGELALYTPCRGQEAAQVGAAACLRKTDWLFPQYRELGVYLVRGIPPGHVGVAWRGTWHGGLQFTTKCCAPMSVPIGTQTLHAVGAAMAAQRLDEDSVTVAFLGDGATSEGDVHEALNFAAVFTTPCVFYVQNNQWAISMPVSRQTAAPSIAHKAIGYGMPGIRVDGNDVLACYAVMAEAAARARAGDGPTLIEAVTYRLGPHTTADDPTRYRSQEEVDRWATLDPIPRYRTYLQDQGLWSQRLEEQVTARAKHVRSELRDAVFDAPDFDVDEVFTTVYAEITPGLQAQREQLRAELARTD
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for bkdA? Email the maintainer — the message is pre-filled with this gene's details.