bkdA Family assigned · medium auto-curated

H37Rv Rv2497c · MTBC0 mtbc0_002659 · 367 aa · 2833883–2834986 (-) · RefSeq NP_217013.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)3-methyl-2-oxobutanoate dehydrogenase subunit alpha
MTBC0 PGAP re-annotationpyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha
Revised (this work)Pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha. Pfam: E1_dh (PF00676.26), DXP_synthase_N (PF13292.12).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WIS3 SwissProt · reviewed · Evidence at protein level
UniProt name3-methyl-2-oxobutanoate dehydrogenase subunit alpha
EC (curated) EC 1.2.4.4
Curated functionComponent of the branched-chain alpha-keto dehydrogenase complex, which catalyzes the overall conversion of alpha-keto acids derived from the branched-chain amino-acids valine, leucine and isoleucine to acyl-CoA and CO(2). The complex contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3) (By similarity). The E1 subunit catalyzes the first step with the decarboxylation of the alpha-ketoacid forming an enzyme-product intermediate (By similarity).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
Preferred namepdhA
eggNOG descriptionDehydrogenase E1 component
Orthologous groupCOG1071
EC number EC 1.2.4.1, EC 1.2.4.4
KEGG orthology K00161, K00166
KEGG pathways map00010, map00020, map00280, map00620, map00640, map01100, map01110, map01120, map01130, map01200, map04066, map04922, map05230
KEGG modules M00036, M00307

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.332 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
E1_dhPF00676.26 6.9e-8648–332 Dehydrogenase E1 component
DXP_synthase_NPF13292.12 6.1e-06148–208 1-deoxy-D-xylulose-5-phosphate synthase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: bkdC (branched-chain keto acid dehydrogenase E2 component), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2495c bkdC branched-chain keto acid dehydrogenase E2 component 999 1000 ctx neighborhood:879 cooccurence:773 coexpression:925 experimental:415 database:957 textmining:720
Rv2496c bkdB 3-methyl-2-oxobutanoate dehydrogenase subunit beta 999 1000 ctx neighborhood:879 fusion:900 cooccurence:774 coexpression:942 experimental:829 database:965 textmining:682
Rv0462 lpdC dihydrolipoamide dehydrogenase 989 985 coexpression:500 database:956
Rv2215 dlaT pyruvate dehydrogenase E2 component dihydrolipoamide acyltransferase 981 974 ctx cooccurence:746 coexpression:603 experimental:415 database:591
Rv1248c kgd multifunctional 2-oxoglutarate dehydrogenase E1 component /2-oxoglutarate dehydrogenase dihydrolipoyllysine-residue succinyltransferase 975 962 coexpression:600 experimental:415 database:844
Rv2332 mez malate oxidoreductase 932 907 database:900
Rv1734c hyp hypothetical protein 930 907 coexpression:598 experimental:415 database:591
Rv1617 pykA pyruvate kinase 923 907 database:900
Rv2967c pca pyruvate carboxylase 910 906 database:900
Rv2455c korA 2-oxoglutarate oxidoreductase subunit KorA 949 905 database:900 textmining:497
Rv2241 aceE pyruvate dehydrogenase E1 component 970 904 database:900 textmining:703
Rv1127c ppdK pyruvate, phosphate dikinase PpdK 911 904 database:900
Rv0694 mftD mycofactocin system heme/flavin oxidoreductase MftD 906 903 database:900
Rv1872c lldD2 L-lactate dehydrogenase 906 903 database:900
Rv2454c korB 2-oxoglutarate oxidoreductase subunit KorB 926 902 database:900

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 3-methyl-2-oxobutanoate dehydrogenase subunit alpha
  • MTBC0 PGAP product: pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha
  • Pfam (hmmscan --cut_ga): E1_dh PF00676.26 (E=7e-86), DXP_synthase_N PF13292.12 (E=6e-06)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217013.1)
  • Domains: Pfam-A via hmmscan --cut_ga — E1_dh (PF00676.26), DXP_synthase_N (PF13292.12)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1071
  • Curated reference: UniProt P9WIS3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 69 functional partner(s); context anchor bkdC
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002659|Rv2497c|bkdA
MGEGSRRPSGMLMSVDLEPVQLVGPDGTPTAERRYHRDLPEETLRWLYEMMVVTRELDTEFVNLQRQGELALYTPCRGQEAAQVGAAACLRKTDWLFPQYRELGVYLVRGIPPGHVGVAWRGTWHGGLQFTTKCCAPMSVPIGTQTLHAVGAAMAAQRLDEDSVTVAFLGDGATSEGDVHEALNFAAVFTTPCVFYVQNNQWAISMPVSRQTAAPSIAHKAIGYGMPGIRVDGNDVLACYAVMAEAAARARAGDGPTLIEAVTYRLGPHTTADDPTRYRSQEEVDRWATLDPIPRYRTYLQDQGLWSQRLEEQVTARAKHVRSELRDAVFDAPDFDVDEVFTTVYAEITPGLQAQREQLRAELARTD