Rv2517c Still unknown · low auto-curated
H37Rv Rv2517c · MTBC0 mtbc0_002680 ·
83 aa · 2856400–2856651 (-) ·
RefSeq NP_217033.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | hypothetical protein |
| Revised (this work) | Conserved hypothetical protein; no recognised domain. Function unknown. Foldseek best (non-significant) hit: 7ax2-assembly1_A Crystal structure of the computationally designed Sco (prob 0.51, TM 0.79). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O53222
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | Uncharacterized protein |
UniProt still lists this protein as Uncharacterized protein; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| Orthologous group | 2B0X9 |
|---|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Structural neighbours (Foldseek on the ESMFold model, exploratory)
ESMFold model confidence: mean pLDDT 84.2 (confident). A confident model makes the fold comparison meaningful.
Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.
| Target | Prob | TM | E-value | Description |
|---|---|---|---|---|
7ax2-assembly1_A |
0.51 | 0.79 | 1.5e+00 | 7ax2-assembly1_A Crystal structure of the computationally designed Scone-E protein co-crystallized with STA, form b |
1whz-assembly1_A |
0.41 | 0.61 | 1.0e+00 | 1whz-assembly1_A Crystal structure of a hypothetical protein from thermus thermophilus HB8 |
5uka-assembly1_B |
0.28 | 0.54 | 8.0e-01 | 5uka-assembly1_B Salmonella typhimurium AhpC E49Q mutant |
3emp-assembly1_D-2 |
0.23 | 0.55 | 1.2e+00 | 3emp-assembly1_D-2 Crystal Structure of the S-acetanilide modified form of C165S AhpC |
8pu0-assembly1_A |
0.23 | 0.77 | 3.8e+00 | 8pu0-assembly1_A Cryo-EM structure of human Elp123 in complex with tRNA, desulpho-CoA, 5'-deoxyadenosine and methionine |
6tjg-assembly1_A |
0.21 | 0.52 | 5.1e-01 | 6tjg-assembly1_A Crystal structure of the computationally designed Cake8 protein |
5enu-assembly2_B |
0.18 | 0.41 | 4.5e-01 | 5enu-assembly2_B Crystal structure of an alkyl hyroperoxide reductase from Burkholderia ambifaria |
1yex-assembly1_A |
0.18 | 0.46 | 7.5e-01 | 1yex-assembly1_A Structural and biochemical analysis of the link between enzymatic activity and oligomerization in AhpC, a bacterial peroxiredoxin. |
Functional interaction network (STRING v12, guilt-by-association)
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2516c hyp |
hypothetical protein | 904 | 904 ctx | neighborhood:882 |
Rv2515c hyp |
hypothetical protein | 515 | 516 ctx | neighborhood:513 |
Rv2514c hyp |
hypothetical protein | 514 | 515 ctx | neighborhood:513 |
Rv3290c lat |
L-lysine-epsilon aminotransferase | 634 | 59 | textmining:627 |
Rv2497c bkdA |
3-methyl-2-oxobutanoate dehydrogenase subunit alpha | 400 | 55 | |
Rv1152 |
transcriptional regulator | 805 | 51 | textmining:803 |
Rv0095c hyp |
hypothetical protein | 544 | 51 | textmining:540 |
Rv1588c hyp |
hypothetical protein | 804 | 47 | textmining:803 |
Rv1805c hyp |
hypothetical protein | 656 | 44 | textmining:655 |
Rv1057 hyp |
hypothetical protein | 437 | 44 | textmining:436 |
Rv2593c ruvA |
Holliday junction ATP-dependent DNA helicase RuvA | 510 | 41 | textmining:510 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: hypothetical protein
- Foldseek best: 7ax2-assembly1_A Crystal structure of the computationally designed Scone-E prote (prob 0.51, E=2e+00, TM=0.79)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217033.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2B0X9 - Curated reference: UniProt O53222 (TrEMBL, unreviewed; Predicted)
- Model confidence: ESMFold per-residue pLDDT (mean 84.2, confident)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 11 functional partner(s)
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002680|Rv2517c| MNSAIIKIAKWAQSQQWTVEDDASGYTRFYNPQGVYIARFPATPSNEYRRMRDLLGALKKAGLTWPPPSKKERRAQHRKEGAQ