Rv2517c Still unknown · low auto-curated

H37Rv Rv2517c · MTBC0 mtbc0_002680 · 83 aa · 2856400–2856651 (-) · RefSeq NP_217033.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Conserved hypothetical protein; no recognised domain. Function unknown. Foldseek best (non-significant) hit: 7ax2-assembly1_A Crystal structure of the computationally designed Sco (prob 0.51, TM 0.79).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53222 TrEMBL · unreviewed · Predicted
UniProt nameUncharacterized protein

UniProt still lists this protein as Uncharacterized protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2B0X9

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 84.2 (confident). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
7ax2-assembly1_A 0.51 0.79 1.5e+00 7ax2-assembly1_A Crystal structure of the computationally designed Scone-E protein co-crystallized with STA, form b
1whz-assembly1_A 0.41 0.61 1.0e+00 1whz-assembly1_A Crystal structure of a hypothetical protein from thermus thermophilus HB8
5uka-assembly1_B 0.28 0.54 8.0e-01 5uka-assembly1_B Salmonella typhimurium AhpC E49Q mutant
3emp-assembly1_D-2 0.23 0.55 1.2e+00 3emp-assembly1_D-2 Crystal Structure of the S-acetanilide modified form of C165S AhpC
8pu0-assembly1_A 0.23 0.77 3.8e+00 8pu0-assembly1_A Cryo-EM structure of human Elp123 in complex with tRNA, desulpho-CoA, 5'-deoxyadenosine and methionine
6tjg-assembly1_A 0.21 0.52 5.1e-01 6tjg-assembly1_A Crystal structure of the computationally designed Cake8 protein
5enu-assembly2_B 0.18 0.41 4.5e-01 5enu-assembly2_B Crystal structure of an alkyl hyroperoxide reductase from Burkholderia ambifaria
1yex-assembly1_A 0.18 0.46 7.5e-01 1yex-assembly1_A Structural and biochemical analysis of the link between enzymatic activity and oligomerization in AhpC, a bacterial peroxiredoxin.

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv2516c hyp hypothetical protein 904 904 ctx neighborhood:882
Rv2515c hyp hypothetical protein 515 516 ctx neighborhood:513
Rv2514c hyp hypothetical protein 514 515 ctx neighborhood:513
Rv3290c lat L-lysine-epsilon aminotransferase 634 59 textmining:627
Rv2497c bkdA 3-methyl-2-oxobutanoate dehydrogenase subunit alpha 400 55
Rv1152 transcriptional regulator 805 51 textmining:803
Rv0095c hyp hypothetical protein 544 51 textmining:540
Rv1588c hyp hypothetical protein 804 47 textmining:803
Rv1805c hyp hypothetical protein 656 44 textmining:655
Rv1057 hyp hypothetical protein 437 44 textmining:436
Rv2593c ruvA Holliday junction ATP-dependent DNA helicase RuvA 510 41 textmining:510

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: hypothetical protein
  • Foldseek best: 7ax2-assembly1_A Crystal structure of the computationally designed Scone-E prote (prob 0.51, E=2e+00, TM=0.79)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217033.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2B0X9
  • Curated reference: UniProt O53222 (TrEMBL, unreviewed; Predicted)
  • Model confidence: ESMFold per-residue pLDDT (mean 84.2, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 11 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002680|Rv2517c|
MNSAIIKIAKWAQSQQWTVEDDASGYTRFYNPQGVYIARFPATPSNEYRRMRDLLGALKKAGLTWPPPSKKERRAQHRKEGAQ