Rv2514c Family assigned · low auto-curated

H37Rv Rv2514c · MTBC0 mtbc0_002677 · 153 aa · 2853767–2854228 (-) · RefSeq NP_217030.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationDUF4411 family protein
Revised (this work)DUF4411 family protein.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6Y0Y0 TrEMBL · unreviewed · Predicted
UniProt nameDUF4411 family protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionDomain of unknown function (DUF4411)
Orthologous groupCOG1487

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.952 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF4411PF14367.13 4.7e-453–153 Domain of unknown function (DUF4411)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1371 (membrane protein), high confidence from genomic context alone (score 707 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2515c hyp hypothetical protein 998 994 ctx neighborhood:882 cooccurence:774 coexpression:802 textmining:803
Rv1371 membrane protein 707 707 ctx cooccurence:703
Rv2608 PPE42 PPE family protein PPE42 644 644 ctx cooccurence:639
Rv2939 papA5 phthiocerol/phthiodiolone dimycocerosyl transferase 640 640 ctx cooccurence:638
Rv2516c hyp hypothetical protein 514 515 ctx neighborhood:513
Rv2517c hyp hypothetical protein 514 515 ctx neighborhood:513
Rv0878c PPE13 PPE family protein PPE13 440 440 ctx cooccurence:435
Rv0300 vapB2 antitoxin VapB2 433 434 experimental:412
Rv1917c PPE34 PPE family protein PPE34 412 413
Rv2601A vapB41 antitoxin VapB41 429 407
Rv1952 vapB14 antitoxin VapB14 429 407
Rv1270c lprA lipoprotein LprA 400 401
Rv2017 transcriptional regulator 664 78 textmining:651
Rv0268c hyp hypothetical protein 868 63 textmining:865
Rv0366c hyp hypothetical protein 662 56 textmining:657

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: DUF4411 family protein
  • Pfam (hmmscan --cut_ga): DUF4411 PF14367.13 (E=5e-45)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217030.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF4411 (PF14367.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1487
  • Curated reference: UniProt I6Y0Y0 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 27 functional partner(s); context anchor Rv1371
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002677|Rv2514c|
MLYSFDTSAILNGRRDLFRPAVFRSLWGRVEDAISAGQIRSVDEVQRELARRDDDAKRWADGQTGLFCPLDEQIQQAARHILRLHPNMVRQGGRRSAADPFVIALAMVNNATVVTQETASGNIEKPRIPDVCDALGVPWLTLMGYIEAQGWTF