Rv2499c Family assigned · medium auto-curated

H37Rv Rv2499c · MTBC0 mtbc0_002661 · 185 aa · 2836063–2836620 MTBC0 (-) · RefSeq NP_217015.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand Rv2491 (Rv2491) — family_assigned: TIGR00725 family protein Rv2492 (Rv2492) — requalified: hypothetical protein vapB38 (Rv2493) — requalified: antitoxin vapC38 (Rv2494) — family_assigned: type II toxin-antitoxin system VapC family toxin bkdC (Rv2495c) — family_assigned: dihydrolipoamide acetyltransferase family protein bkdC bkdB (Rv2496c) — family_assigned: 3-methyl-2-oxobutanoate dehydrogenase subunit beta bkdB bkdA (Rv2497c) — family_assigned: pyruvate dehydrogenase (acetyl-transferring) E1 component su bkdA citE (Rv2498c) — family_assigned: citrate (pro-3S)-lyase subunit beta Rv2499c (Rv2499c) — family_assigned: MaoC family dehydratase fadE19 (Rv2500c) — family_assigned: acyl-CoA dehydrogenase family protein fadE19 accA1 (Rv2501c) — family_assigned: acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alph accA1 accD1 (Rv2502c) — family_assigned: acetyl-/propionyl-CoA carboxylase subunit beta accD1 scoB (Rv2503c) — family_assigned: succinyl-CoA--3-ketoacid CoA transferase subunit B scoA (Rv2504c) — family_assigned: succinyl-CoA--3-ketoacid CoA transferase subunit A fadD35 (Rv2505c) — family_assigned: AMP-binding protein fadD35 Rv2506 (Rv2506) — family_assigned: TetR/AcrR family transcriptional regulator Rv2507 (Rv2507) — family_assigned: MmpS family transport accessory protein Rv2508c (Rv2508c) — requalified: MFS transporter Rv2508c cmrA (Rv2509) — requalified: mycolate reductase 2 828 kb 2 832 kb 2 836 kb 2 840 kb 2 844 kb 2 848 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)oxidase regulatory-like protein
MTBC0 PGAP re-annotationMaoC family dehydratase
Revised (this work)MaoC family dehydratase. Pfam: MC_hydratase (PF19315.6), MaoC_dehydratas (PF01575.26).
Functional category (TubercuList)intermediary metabolism and respiration

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 1 publication

1 TB publication mentions this gene. 1 publication(s) discuss this gene (1 in a M. tuberculosis context).

PublicationDate
Itaconate mechanism of action and dissimilation in Mycobacterium tuberculosis. doi:10.1073/pnas.2423114122 2025

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene

NeighbourcitE (Rv2498c, - strand)
Overlap4 bp, 1 % of this gene's length

co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.

Conditional expression context (iModulons)

Member of 1 independently-modulated gene set(s): BkaR (bkaR).

iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).

CRISPRi vulnerability

Vulnerability index 1.20 (95% CI -1.12 to 4.77). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionFunction unknown

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb2527c · 99.5% identity
M. marinum MMAR_3846 · 90.0% identity
M. smegmatis MSMEG_4714 · 72.3% identity
M. orygis RJtmp_002584 · 99.5% identity
M. abscessus MAB_4379c · 69.6% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt I6Y9H2 TrEMBL · unreviewed · Evidence at protein level
UniProt namePossible oxidase regulatory-related protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
eggNOG descriptiondehydratase
Orthologous groupCOG2030

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.068 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

M. canettii dN/dS (deep-divergence selection) inf (low power) · 1 consensus substitution(s)
low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 52/53 (98%) · mean identity 83.0% · 4/4 closest MTBAP relatives
conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 8/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 63.0%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 6 in the ORF — 0 in the essential state, 0 growth-defect, 6 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 51.1666666667. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
CaveatRead with some caution: only 6 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 6 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3)

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype

Conditionlog2FCqEffect
fitness in mouse infection (in vivo) -2.740.0 required

Conditional fitness of transposon-disruption mutants across 1 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.

Proteomics (mass spectrometry) detected

MS detectiondetected in 11 of 16 independent MS datasets
Integrated abundance87.3 ppm · rank 1397/3519 (60.3th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Predicted localisation (DeepTMHMM + lipobox) lipoprotein

Predictionpredicted lipoprotein (lipobox + signal peptide)
DeepTMHMM classGLOB
Lipoboxsignal-peptidase-II lipobox; lipidated Cys near position 17

Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.

Physico-chemical properties (computed, ProtParam)

Length185 aa
Molecular weight20.3 kDa
Theoretical pI8.69
GRAVY-0.231 (hydrophilic)
Aliphatic index81.1
Aromaticity0.065
Instability index33.1 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
MC_hydratasePF19315.6 9.5e-1230–179 Mesaconyl-CoA hydratase
MaoC_dehydratasPF01575.26 4.0e-2939–159 MaoC like domain

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 89.9

PDB hitprobTM-scoreE-valueDescription
4ffu-assembly1_D 1.00 0.85 1.7e-13 sig 4ffu-assembly1_D CRYSTAL STRUCTURE OF putative MaoC-like (monoamine oxidase-like) protein, similar to NodN from Sinorhizo Bium meliloti 1021
1q6w-assembly2_C 1.00 0.86 3.3e-13 sig 1q6w-assembly2_C X-Ray structure of Monoamine oxidase regulatory protein from Archaeoglobus fulgius
4e3e-assembly1_A 1.00 0.91 2.7e-11 sig 4e3e-assembly1_A CRYSTAL STRUCTURE OF putative MaoC domain protein dehydratase from Chloroflexus aurantiacus J-10-fl
3exz-assembly1_A 1.00 0.88 2.3e-11 sig 3exz-assembly1_A Crystal structure of the MaoC-like dehydratase from Rhodospirillum rubrum. Northeast Structural Genomics Consortium target RrR103a.
8hgn-assembly1_A 1.00 0.86 3.8e-11 sig 8hgn-assembly1_A Crystal structure of MeaC (Mesaconyl-CoA hydratase)

Foldseek search of the AlphaFold DB model (mean pLDDT 89.9, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 7

Upstream (5' on genome)citE (- strand, -4 bp gap)
Downstream (3' on genome)fadE19 (- strand, -4 bp gap)
Predicted operon citE · Rv2499c · fadE19 · accA1 · accD1 · scoB · scoA

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (2 TF) Rv0023 (represses) · Rv2506 (represses)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: citE (citrate (pro-3S)-lyase subunit beta), high confidence from genomic context alone (score 993 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2498c citE citrate (pro-3S)-lyase subunit beta 998 993 ctx neighborhood:882 cooccurence:760 coexpression:761 textmining:816
Rv2500c fadE19 acyl-CoA dehydrogenase FadE19 998 990 ctx neighborhood:881 coexpression:844 textmining:815
Rv2502c accD1 acetyl-/propionyl-CoA carboxylase subunit beta 950 933 ctx neighborhood:881
Rv2501c accA1 acetyl/propionyl-CoA carboxylase subuit alpha 939 933 ctx neighborhood:881
Rv2503c scoB succinyl-CoA:3-ketoacid-CoA transferase subunit B 935 889 ctx neighborhood:881 textmining:438
Rv2504c scoA succinyl-CoA:3-ketoacid-CoA transferase subunit A 981 887 ctx neighborhood:881 textmining:845
Rv2506 TetR family transcriptional regulator 870 829 ctx neighborhood:714 cooccurence:413
Rv2495c bkdC branched-chain keto acid dehydrogenase E2 component 845 815 ctx neighborhood:723
Rv2497c bkdA 3-methyl-2-oxobutanoate dehydrogenase subunit alpha 807 784 ctx neighborhood:724
Rv2496c bkdB 3-methyl-2-oxobutanoate dehydrogenase subunit beta 736 737 ctx neighborhood:723
Rv3339c icd1 exp isocitrate dehydrogenase 651 636 database:476
Rv2505c fadD35 fatty-acid--CoA ligase FadD35 717 618 ctx neighborhood:567
Rv1223 htrA exp serine protease HtrA 575 576 database:498
Rv0983 pepD exp serine protease PepD 569 569 database:498
Rv3564 fadE33 acyl-CoA dehydrogenase FadE33 584 568

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: oxidase regulatory-like protein
  • MTBC0 PGAP product: MaoC family dehydratase
  • Pfam (hmmscan --cut_ga): MC_hydratase PF19315.6 (E=9e-12), MaoC_dehydratas PF01575.26 (E=4e-29)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217015.1)
  • Domains: Pfam-A via hmmscan --cut_ga — MC_hydratase (PF19315.6), MaoC_dehydratas (PF01575.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2030
  • Curated reference: UniProt I6Y9H2 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 89.9)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 134 functional partner(s); context anchor citE
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide; (myco)bacterial lipobox (Sutcliffe & Harrington 2004, doi:10.1099/mic.0.26804-0)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002661|Rv2499c|
MTKHAGDRESDDAVSACRVAGSTVGRRILQRGLWFEEFQIGTTYLHRPGRTVTEADNVLFTTLTMNTQSLHLDAAWAGQQPGFRGERLVNSMFTLSTMVGLSVAQLTLGTIVANLGFSEVSFPKPVFHGDTLYAETVCTGKRESKSRPGEGIVTLEHIARNQHGEVVARAVRTTLVQKQSIKEAQ