Rv2516c Still unknown · low auto-curated

H37Rv Rv2516c · MTBC0 mtbc0_002679 · 267 aa · 2855600–2856403 (-) · RefSeq NP_217032.2

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Conserved hypothetical protein; no recognised domain. Function unknown. Foldseek best (non-significant) hit: 7b90-assembly1_E Circular permutant of ribosomal protein S6, P54-55 tr (prob 0.99, TM 0.64).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6YDM0 TrEMBL · unreviewed · Evidence at protein level
UniProt nameHelix-turn-helix domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2ENST

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.113 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 7 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 86.2 (confident). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
7b90-assembly1_E 0.99 0.64 1.2e-01 7b90-assembly1_E Circular permutant of ribosomal protein S6, P54-55 truncated, I8A mutant
7bff-assembly1_E 0.99 0.65 1.4e-01 7bff-assembly1_E Circular permutant of ribosomal protein S6, P54-55 truncated, I25A mutant.
7bfd-assembly1_K 0.98 0.66 2.4e-01 7bfd-assembly1_K Circular permutant of ribosomal protein S6, P54-55 truncated, Y4A mutant.
7lwr-assembly1_A 0.97 0.73 4.9e-01 7lwr-assembly1_A Structural and Biochemical Insight into Assembly of Molecular Motors Involved in Viral DNA Packaging
5d90-assembly2_C 0.96 0.68 4.6e-01 5d90-assembly2_C Crystal structure of HiNmlR, a MerR family regulator lacking the sensor domain, bound to promoter DNA
7bfe-assembly1_E 0.95 0.66 4.6e-01 7bfe-assembly1_E Circular permutant of ribosomal protein S6, P54-55 truncated, L21A mutant.
7lxs-assembly1_A 0.94 0.71 6.4e-01 7lxs-assembly1_A Structural and Biochemical Insight into Assembly of Molecular Motors Involved in Viral DNA Packaging
5d8c-assembly1_A 0.94 0.71 6.4e-01 5d8c-assembly1_A Crystal structure of HiNmlR, a MerR family regulator lacking the sensor domain, bound to promoter DNA

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv2517c hyp hypothetical protein 904 904 ctx neighborhood:882
Rv2515c hyp hypothetical protein 578 578 ctx neighborhood:566
Rv2514c hyp hypothetical protein 514 515 ctx neighborhood:513

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: hypothetical protein
  • Foldseek best: 7b90-assembly1_E Circular permutant of ribosomal protein S6, P54-55 truncated, I (prob 0.99, E=1e-01, TM=0.64)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217032.2)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2ENST
  • Curated reference: UniProt I6YDM0 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 86.2, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 3 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002679|Rv2516c|
MTADWVVTFTFDADPSMETMDAWETQLEGFDALVSRVPGHGIDVTVYAPGDWSVFDALAKMAGEVMPVVQAKSPIAVQIISEPEHRLRAEAFTTPELMSAAEIADELGVSRQRVHQLRSTAGFPAPLADLRGGAVWDAAAVRRFAETWERKPGRPHTGTAKFAYSWAVGPAVGRSGKAPNVRWRVENPDKIRFVLRNIGDDIAEDVEIDLSRIDAITRNVPKKTVIRPGEGLNMVLIAAWGHPLPNQLYVRWAGQDEWAAVPLHPAH