Rv2407 Family assigned · medium auto-curated

H37Rv Rv2407 · MTBC0 mtbc0_002563 · 280 aa · 2728944–2729786 (+) · RefSeq NP_216923.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ribonuclease Z
MTBC0 PGAP re-annotationRv2407 family type 3 sulfatase
Revised (this work)Rv2407 family type 3 sulfatase. Pfam: Anti-Pycsar_Apyc1 (PF23023.2), Lactamase_B (PF00753.34), Lactamase_B_2 (PF12706.14).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WGZ5 SwissProt · reviewed · Inferred from homology
UniProt nameRibonuclease Z
EC (curated) EC 3.1.26.11
Curated functionZinc phosphodiesterase, which displays some tRNA 3'-processing endonuclease activity. Probably involved in tRNA maturation, by removing a 3'-trailer from precursor tRNA.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namernz
eggNOG descriptionZinc phosphodiesterase, which displays some tRNA 3'- processing endonuclease activity. Probably involved in tRNA maturation, by removing a 3'-trailer from precursor tRNA
Orthologous groupCOG1234
EC number EC 3.1.26.11
KEGG orthology K00784
KEGG pathways map03013

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.081 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Anti-Pycsar_Apyc1PF23023.2 4.6e-133–204 Anti-Pycsar protein Apyc1
Lactamase_BPF00753.34 1.1e-1218–179 Metallo-beta-lactamase superfamily
Lactamase_B_2PF12706.14 2.3e-1932–241 Beta-lactamase superfamily domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3829c (dehydrogenase), medium confidence from genomic context alone (score 546 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2406c hyp hypothetical protein 548 548 ctx neighborhood:548
Rv3829c dehydrogenase 548 546 ctx cooccurence:541
Rv0668 rpoC DNA-directed RNA polymerase subunit beta' 465 465
Rv0045c hydrolase 429 429 ctx cooccurence:428
Rv0712 hyp hypothetical protein 891 200 textmining:870
Rv3762c hydrolase 888 166 textmining:872
Rv1730c penicillin-binding protein 673 80 textmining:660
Rv2837c nrnA bifunctional oligoribonuclease/PAP phosphatase NrnA 881 72 textmining:878
Rv3849 espR ESX-1 transcriptional regulator EspR 436 47 textmining:433
Rv3205c hyp hypothetical protein 870 41 textmining:870
Rv0484c short-chain type oxidoreductase 870 41 textmining:870
Rv2511 orn oligoribonuclease 410 41 textmining:411

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ribonuclease Z
  • MTBC0 PGAP product: Rv2407 family type 3 sulfatase
  • Pfam (hmmscan --cut_ga): Anti-Pycsar_Apyc1 PF23023.2 (E=5e-13), Lactamase_B PF00753.34 (E=1e-12), Lactamase_B_2 PF12706.14 (E=2e-19)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216923.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Anti-Pycsar_Apyc1 (PF23023.2), Lactamase_B (PF00753.34), Lactamase_B_2 (PF12706.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1234
  • Curated reference: UniProt P9WGZ5 (SwissProt, reviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 12 functional partner(s); context anchor Rv3829c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002563|Rv2407|
MLEITLLGTGSPIPDPDRAGPSTLVRAGAQAFLVDCGRGVLQRAAAVGVGAAGLSAVLLTHLHSDHIAELGDVLITSWVTNFAADPAPLPIIGPPGTAEVVEATLKAFGHDIGYRIAHHADLTTPPPIEVHEYTAGPAWDRDGVTIRVAPTDHRPVTPTIGFRIESDGASVVLAGDTVPCDSLDQLAAGADALVHTVIRKDIVTQIPQQRVKDICDYHSSVQEAAATANRAGVGTLVMTHYVPAIGPGQEEQWRALAATEFSGRIEVGNDLHRVEVHPRR