rpmH Resolved · high auto-curated

H37Rv Rv3924c · MTBC0 - · 47 aa · 4410786–4410929 (-) · RefSeq NP_218441.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)50S ribosomal protein L34
MTBC0 PGAP re-annotation
Revised (this work)50S ribosomal protein L34. Pfam: Ribosomal_L34 (PF00468.23).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WH93 SwissProt · reviewed · Evidence at protein level
UniProt nameLarge ribosomal subunit protein bL34

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namerpmH
eggNOG descriptionBelongs to the bacterial ribosomal protein bL34 family
Orthologous groupCOG0230
KEGG orthology K02914
KEGG pathways map03010
KEGG modules M00178

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Ribosomal_L34PF00468.23 9.4e-185–47 Ribosomal protein L34

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv1642 rpmI 50S ribosomal protein L35 999 1000 coexpression:647 experimental:999
Rv2909c rpsP 30S ribosomal protein S16 999 1000 coexpression:652 experimental:999
Rv2441c rpmA 50S ribosomal protein L27 999 1000 coexpression:605 experimental:999
Rv2442c rplU 50S ribosomal protein L21 999 1000 coexpression:666 experimental:999 textmining:482
Rv2785c rpsO 30S ribosomal protein S15 999 1000 coexpression:647 experimental:999
Rv3461c rpmJ 50S ribosomal protein L36 999 1000 coexpression:539 experimental:999
Rv3456c rplQ 50S ribosomal protein L17 999 1000 coexpression:578 experimental:999
Rv3443c rplM 50S ribosomal protein L13 999 1000 coexpression:656 experimental:999
Rv2412 rpsT 30S ribosomal protein S20 999 1000 coexpression:661 experimental:999
Rv3459c rpsK 30S ribosomal protein S11 999 1000 coexpression:585 experimental:999
Rv2904c rplS 50S ribosomal protein L19 999 1000 coexpression:646 experimental:999
Rv1643 rplT 50S ribosomal protein L20 999 1000 coexpression:575 experimental:999
Rv0682 rpsL 30S ribosomal protein S12 999 1000 coexpression:646 experimental:999 textmining:415
Rv3458c rpsD 30S ribosomal protein S4 999 1000 coexpression:609 experimental:999
Rv3442c rpsI 30S ribosomal protein S9 999 1000 coexpression:557 experimental:999

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): 50S ribosomal protein L34
  • Pfam (hmmscan --cut_ga): Ribosomal_L34 PF00468.23 (E=9e-18)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218441.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Ribosomal_L34 (PF00468.23)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0230
  • Curated reference: UniProt P9WH93 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 126 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3924c|rpmH
MTKGKRTFQPNNRRRARVHGFRLRMRTRAGRSIVSSRRRKGRRTLSA