Rv2415c Family assigned · medium auto-curated

H37Rv Rv2415c · MTBC0 mtbc0_002571 · 297 aa · 2737159–2738052 MTBC0 (-) · RefSeq NP_216931.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationComEA family DNA-binding protein
Revised (this work)ComEA family DNA-binding protein. Pfam: SLBB (PF10531.16), HHH_3 (PF12836.14), HHH (PF00633.30).
Functional category (TubercuList)conserved hypotheticals

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) never studied

No publication in PubMed mentions this gene in its title or abstract — not under its H37Rv locus tag, nor under any of its ortholog identifiers (M. bovis, M. marinum, M. smegmatis, M. leprae, M. abscessus). The atlas annotation rests on sequence/structure evidence, not on a primary study of this gene.

A verified absence of literature is itself information: it flags an annotation with no primary study behind it. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole), MULTI-ALIAS sweep: H37Rv locus tag AND every ortholog identifier (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), each hit VERIFIED against the abstract text (word-boundary regex). phase73/phase75, 2026-07-13.

Intrinsic disorder (sequence + structure) highly disordered

Predicted disorder50% of residues (metapredict) · mean AlphaFold pLDDT 74.5
Disordered regions2 IDR(s), longest 136 aa [0-136, 200-235]

sequence-based disorder is high but AlphaFold folds it confidently (pLDDT>=70): treat the disorder call with caution (possible metapredict over-call)

A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).

Conditional expression context (iModulons)

Member of 1 independently-modulated gene set(s): WhiB7 (whiB7).

iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).

CRISPRi vulnerability

Vulnerability index 1.18 (95% CI -0.68 to 4.07). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser) ahead of Mycobrowser

Mycobrowser functionFunction unknown

Mycobrowser classes this locus among conserved hypotheticals; the atlas now assigns a functional handle (COG category). Mycobrowser is no longer maintained, so its EC numbers predate recent nomenclature revisions (e.g. the 2018 EC 7 "translocase" class) — most EC differences are re-numberings of the same enzyme, not conflicts.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb2438c · 99.7% identity
M. marinum MMAR_3736 · 67.8% identity
M. smegmatis MSMEG_4574 · 52.1% identity
M. orygis RJtmp_002497 · 99.7% identity
M. abscessus MAB_1626 · 50.8% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P71728 TrEMBL · unreviewed · Predicted
UniProt nameHelix-hairpin-helix DNA-binding motif class 1 domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
Preferred namecomEA
eggNOG descriptionTIGRFAM Competence protein ComEA, helix-hairpin-helix
Orthologous groupCOG1555
KEGG orthology K02237
KEGG modules M00429

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.369 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 7 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Corynebacteriales

M. canettii dN/dS (deep-divergence selection) 0.0 · 9 consensus substitution(s)
under purifying selection vs M. canettii (deep divergence; dN/dS=0.0) — a real, constrained gene predating the MTBC clonal expansion
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 49/53 (92%) · mean identity 66.7% · 4/4 closest MTBAP relatives
conserved across the genus (present in 49/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 4/13 non-Mycobacterium reference genomes (down to Corynebacteriales) · mean identity 51.3%
detected across the order Corynebacteriales (Corynebacterium/Nocardia/Rhodococcus/…) but not in more distant Actinomycetia — a Corynebacteriales-level gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 14 in the ORF — 0 in the essential state, 0 growth-defect, 14 non-essential, 0 growth-advantage. Saturation 0.929, mean read count 77.9230769231. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) not detected

Not detected in the mass-spectrometry datasets integrated by PaxDb. This is not evidence of absence: low-abundance, condition-specific, or MS-refractory proteins (e.g. small, highly hydrophobic, or repetitive PE/PPE families with few tryptic peptides) are systematically under-sampled.

Predicted localisation (DeepTMHMM + lipobox)

Predictionpredicted membrane protein (1 TM helix)
DeepTMHMM classTM
TM helices (DeepTMHMM)1

Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.

Physico-chemical properties (computed, ProtParam)

Length297 aa
Molecular weight30.5 kDa
Theoretical pI5.24
GRAVY-0.145 (hydrophilic)
Aliphatic index92.3
Aromaticity0.017
Instability index35.1 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
SLBBPF10531.16 8.0e-09139–193 SLBB domain
HHH_3PF12836.14 7.7e-20234–296 Helix-hairpin-helix motif
HHHPF00633.30 2.7e-08238–263 Helix-hairpin-helix motif

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 74.5

PDB hitprobTM-scoreE-valueDescription
8dss-assembly1_B 1.00 0.48 1.4e-11 sig 8dss-assembly1_B X-ray crystal structure of Geobacillus stearothermophilus ComEA
8dfk-assembly2_C 1.00 0.96 2.0e-04 sig 8dfk-assembly2_C X-ray crystal structure of Bacillus subtilis ComEA
8dss-assembly1_A 1.00 0.94 1.9e-04 sig 8dss-assembly1_A X-ray crystal structure of Geobacillus stearothermophilus ComEA
3bzk-assembly1_A 1.00 0.95 3.3e-03 sig 3bzk-assembly1_A Crystal Structure of the Tex protein from Pseudomonas aeruginosa, crystal form 2
2oce-assembly1_A 1.00 0.93 4.1e-03 sig 2oce-assembly1_A Crystal structure of Tex family protein PA5201 from Pseudomonas aeruginosa

Foldseek search of the AlphaFold DB model (mean pLDDT 74.5, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 3

Upstream (5' on genome)Rv2414c (- strand, 14 bp gap)
Downstream (3' on genome)eis (- strand, 339 bp gap)
Predicted operon Rv2413c · Rv2414c · Rv2415c

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: eis (enhanced intracellular survival protein), high confidence from genomic context alone (score 865 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2414c hyp hypothetical protein 922 898 ctx neighborhood:869
Rv2416c eis enhanced intracellular survival protein 865 865 ctx neighborhood:429 coexpression:774
Rv2413c hyp hypothetical protein 836 830 ctx neighborhood:829
Rv1988 erm(37) 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(37) 740 741 coexpression:732
Rv1257c oxidoreductase 732 733 coexpression:732
Rv2551c hyp hypothetical protein 729 646 coexpression:645
Rv2421c nadD nicotinate-nucleotide adenylyltransferase 543 543
Rv0017c rodA cell division protein RodA 521 503
Rv1258c tap multidrug-efflux transporter 474 474 coexpression:474
Rv2420c rsfS hyp hypothetical protein 467 467
Rv3840 transcriptional regulator 453 453 ctx cooccurence:414
Rv2478c hyp hypothetical protein 567 433 coexpression:417
Rv0648 alpha-mannosidase 430 430 coexpression:430
Rv2417c DegV domain-containing protein 424 425 ctx neighborhood:420
Rv0054 ssb single-strand DNA-binding protein 560 424 coexpression:408

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: ComEA family DNA-binding protein
  • Pfam (hmmscan --cut_ga): SLBB PF10531.16 (E=8e-09), HHH_3 PF12836.14 (E=8e-20), HHH PF00633.30 (E=3e-08)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216931.1)
  • Domains: Pfam-A via hmmscan --cut_ga — SLBB (PF10531.16), HHH_3 (PF12836.14), HHH (PF00633.30)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1555
  • Curated reference: UniProt P71728 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 74.5)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 24 functional partner(s); context anchor eis
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002571|Rv2415c|
MRTELPAERLQRRLGAVPDIDSHAASAHLDPEPHDPTDDGPDHDEPRDDPNSLLPRWLPDTSRGQGWADRIRADPGRAGAVALAVIAALAVLVTVFTLIRDRTEPVMSAKLPPVEPVSPTNPRSSASPGSPDRSGLPVVVSVVGLVHTPGLVTLAPGARIADALQAAGGAVDGADTVGLNMARQLGDGEQIVVGLAPPSGQPRVLGSSVGAGTPGPAGTSGTATTGPKTAPKTAEVLDLNTATVEQLDALPGIGPVTAAAIVAWRQRNGRFTSVDQLADVDGIGPARLDKLRNLVRV