Rv2286c Family assigned · medium auto-curated

H37Rv Rv2286c · MTBC0 mtbc0_002427 · 230 aa · 2583624–2584316 (-) · RefSeq NP_216802.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationDsbA family protein
Revised (this work)DsbA family protein. Pfam: DSBA (PF01323.27), Rv2466c-like (PF22234.3).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WLE7 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv2286c

UniProt still lists this protein as Uncharacterized protein Rv2286c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category Q Secondary metabolites biosynthesis, transport and catabolism
eggNOG descriptionDSBA-like thioredoxin domain
Orthologous groupCOG2761

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 1.331 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 3 missense, 1 nonsense, 2 frameshift
Disruption 3 distinct premature-stop/frameshift site(s); most common in 10.07% of strains (14623) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DSBAPF01323.27 2.9e-133–156 DSBA-like thioredoxin domain
Rv2466c-likePF22234.3 4.7e-2311–189 Mycothiol-dependent nitroreductase Rv2466c

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mca (mycothiol S-conjugate amidase), high confidence from genomic context alone (score 701 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1082 mca mycothiol S-conjugate amidase 701 701 ctx cooccurence:700
Rv0819 mshD mycothiol acetyltransferase 649 650 ctx cooccurence:646
Rv2287 yjcE Na(+)/H(+) transporter 565 565 ctx neighborhood:559
Rv3075c hyp hypothetical protein 549 549 ctx neighborhood:544
Rv2289 cdh CDP-diacylglycerol pyrophosphatase 538 538 ctx neighborhood:531
Rv2288 hyp hypothetical protein 538 538 ctx neighborhood:531
Rv0360c hyp hypothetical protein 495 496 ctx cooccurence:490
Rv1170 mshB 1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase 483 483 ctx cooccurence:483
Rv1331 clpS ATP-dependent Clp protease adapter protein ClpS 477 477 ctx cooccurence:477
Rv2389c rpfD resuscitation-promoting factor RpfD 458 458 ctx cooccurence:453
Rv2450c rpfE resuscitation-promoting factor RpfE 444 444 ctx cooccurence:444
Rv2111c pup ubiquitin-like protein Pup 425 426 ctx cooccurence:424
Rv3260c whiB2 transcriptional regulator WhiB2 414 414 ctx cooccurence:411
Rv0323c hyp hypothetical protein 411 411 ctx cooccurence:400
Rv0760c hyp hypothetical protein 888 180 textmining:870

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: DsbA family protein
  • Pfam (hmmscan --cut_ga): DSBA PF01323.27 (E=3e-13), Rv2466c-like PF22234.3 (E=5e-23)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216802.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DSBA (PF01323.27), Rv2466c-like (PF22234.3)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2761
  • Curated reference: UniProt P9WLE7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 22 functional partner(s); context anchor mca
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002427|Rv2286c|
MTTVDFHFDPLCPFAYQTSVWIRDVRAQLGITINWRFFSLEEINLVAGKKHPWERDWSYGWSLMRIGALLRRTNMSLLDRWYAAIGHELHTLGGKPHDPAVARRLLCDVGVNAAILDAALDDPTTHDDVRADHQRVVAAGGYGVPTLFLDGQCLFGPVLVDPPAGPAALNLWSVVTGMAGLPHVYELQRPKSPADVELIAQQLRPYLDGRDWVSINRGEIVDIDRLAGRS