Rv2286c Family assigned · medium auto-curated
H37Rv Rv2286c · MTBC0 mtbc0_002427 ·
230 aa · 2583624–2584316 (-) ·
RefSeq NP_216802.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | DsbA family protein |
| Revised (this work) | DsbA family protein. Pfam: DSBA (PF01323.27), Rv2466c-like (PF22234.3). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WLE7
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Uncharacterized protein Rv2286c |
UniProt still lists this protein as Uncharacterized protein Rv2286c; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
Q Secondary metabolites biosynthesis, transport and catabolism
|
|---|---|
| eggNOG description | DSBA-like thioredoxin domain |
| Orthologous group | COG2761 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate
| pN/pS | 1.331 · diversifying/relaxed |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 3 missense, 1 nonsense, 2 frameshift |
| Disruption | 3 distinct premature-stop/frameshift site(s); most common in 10.07% of strains (14623) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DSBA | PF01323.27 | 2.9e-13 | 3–156 | DSBA-like thioredoxin domain |
Rv2466c-like | PF22234.3 | 4.7e-23 | 11–189 | Mycothiol-dependent nitroreductase Rv2466c |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: mca (mycothiol S-conjugate amidase), high confidence from genomic context alone (score 701 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1082 mca |
mycothiol S-conjugate amidase | 701 | 701 ctx | cooccurence:700 |
Rv0819 mshD |
mycothiol acetyltransferase | 649 | 650 ctx | cooccurence:646 |
Rv2287 yjcE |
Na(+)/H(+) transporter | 565 | 565 ctx | neighborhood:559 |
Rv3075c hyp |
hypothetical protein | 549 | 549 ctx | neighborhood:544 |
Rv2289 cdh |
CDP-diacylglycerol pyrophosphatase | 538 | 538 ctx | neighborhood:531 |
Rv2288 hyp |
hypothetical protein | 538 | 538 ctx | neighborhood:531 |
Rv0360c hyp |
hypothetical protein | 495 | 496 ctx | cooccurence:490 |
Rv1170 mshB |
1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase | 483 | 483 ctx | cooccurence:483 |
Rv1331 clpS |
ATP-dependent Clp protease adapter protein ClpS | 477 | 477 ctx | cooccurence:477 |
Rv2389c rpfD |
resuscitation-promoting factor RpfD | 458 | 458 ctx | cooccurence:453 |
Rv2450c rpfE |
resuscitation-promoting factor RpfE | 444 | 444 ctx | cooccurence:444 |
Rv2111c pup |
ubiquitin-like protein Pup | 425 | 426 ctx | cooccurence:424 |
Rv3260c whiB2 |
transcriptional regulator WhiB2 | 414 | 414 ctx | cooccurence:411 |
Rv0323c hyp |
hypothetical protein | 411 | 411 ctx | cooccurence:400 |
Rv0760c hyp |
hypothetical protein | 888 | 180 | textmining:870 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: DsbA family protein
- Pfam (hmmscan --cut_ga): DSBA PF01323.27 (E=3e-13), Rv2466c-like PF22234.3 (E=5e-23)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216802.1)
- Domains: Pfam-A via hmmscan --cut_ga — DSBA (PF01323.27), Rv2466c-like (PF22234.3)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2761 - Curated reference: UniProt P9WLE7 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
22 functional partner(s); context anchor
mca - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002427|Rv2286c| MTTVDFHFDPLCPFAYQTSVWIRDVRAQLGITINWRFFSLEEINLVAGKKHPWERDWSYGWSLMRIGALLRRTNMSLLDRWYAAIGHELHTLGGKPHDPAVARRLLCDVGVNAAILDAALDDPTTHDDVRADHQRVVAAGGYGVPTLFLDGQCLFGPVLVDPPAGPAALNLWSVVTGMAGLPHVYELQRPKSPADVELIAQQLRPYLDGRDWVSINRGEIVDIDRLAGRS