Rv2298 Resolved · high auto-curated

H37Rv Rv2298 · MTBC0 mtbc0_002438 · 323 aa · 2593831–2594802 (+) · RefSeq NP_216814.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)oxidoreductase
MTBC0 PGAP re-annotationaldo/keto reductase
Revised (this work)Aldo/keto reductase. Pfam: Aldo_ket_red (PF00248.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WQA7 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized oxidoreductase Rv2298
EC (curated) EC 1.-.-.-

UniProt still lists this protein as Uncharacterized oxidoreductase Rv2298; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
eggNOG descriptionaldo keto reductase family
Orthologous groupCOG0667
Gene Ontology (8) GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0016020, GO:0030312, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 2.805 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 8 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Aldo_ket_redPF00248.28 1.0e-5514–298 Aldo/keto reductase family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: xylB (D-xylulose kinase XylB), medium confidence from genomic context alone (score 532 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1023 eno enolase 646 630 database:597
Rv2971 oxidoreductase 652 606 coexpression:419
Rv3579c rlmB 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB 549 549 database:546
Rv1644 tsnR 23S rRNA methyltransferase TsnR 548 548 database:546
Rv0881 tRNA/rRNA methyltransferase 546 547 database:546
Rv0380c RNA methyltransferase 546 547 database:546
Rv0729 xylB D-xylulose kinase XylB 571 532 ctx cooccurence:483
Rv2970A hyp hypothetical protein 570 513 coexpression:417
Rv3696c glpK glycerol kinase 655 498
Rv1371 membrane protein 514 495 experimental:474
Rv2297 hyp hypothetical protein 481 481 ctx neighborhood:466
Rv0018c pstP phosphoserine/threonine phosphatase PstP 480 481 experimental:474
Rv2296 dhmA1 haloalkane dehalogenase 490 470 ctx neighborhood:417
Rv0009 ppiA iron-regulated peptidyl-prolyl cis-trans isomerase PpiA 484 465 experimental:463
Rv2582 ppiB peptidyl-prolyl cis-trans isomerase B 483 464 experimental:463

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: oxidoreductase
  • MTBC0 PGAP product: aldo/keto reductase
  • Pfam (hmmscan --cut_ga): Aldo_ket_red PF00248.28 (E=1e-55)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216814.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Aldo_ket_red (PF00248.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0667
  • Curated reference: UniProt P9WQA7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 82 functional partner(s); context anchor xylB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002438|Rv2298|
MKYLDVDGIGQVSRIGLGTWQFGSREWGYGDRYATGAARDIVKRARALGVTLFDTAEIYGLGKSERILGEALGDDRTEVVVASKVFPVAPFPAVIKNRERASARRLQLNRIPLYQIHQPNPVVPDSVIMPGMRDLLDSGDIGAAGVSNYSLARWRKADAALGRPVVSNQVHFSLAHPDALEDLVPFAELENRIVIAYSPLAQGLLGGKYGLENRPGGVRALNPLFGTENLRRIEPLLATLRAIAVDVDAKPAQVALAWLISLPGVVAIPGASSVEQLEFNVAAADIELSAQSRDALTDAARAFRPVSTGRFLTDMVREKVSRR