Rv2298 Resolved · high auto-curated
H37Rv Rv2298 · MTBC0 mtbc0_002438 ·
323 aa · 2593831–2594802 (+) ·
RefSeq NP_216814.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | oxidoreductase |
|---|---|
| MTBC0 PGAP re-annotation | aldo/keto reductase |
| Revised (this work) | Aldo/keto reductase. Pfam: Aldo_ket_red (PF00248.28). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WQA7
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Uncharacterized oxidoreductase Rv2298 |
| EC (curated) |
EC 1.-.-.-
|
UniProt still lists this protein as Uncharacterized oxidoreductase Rv2298; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
C Energy production and conversion
|
|---|---|
| eggNOG description | aldo keto reductase family |
| Orthologous group | COG0667 |
| Gene Ontology (8) |
GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0016020, GO:0030312, GO:0044464, GO:0071944
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 2.805 · diversifying/relaxed |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 8 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Aldo_ket_red | PF00248.28 | 1.0e-55 | 14–298 | Aldo/keto reductase family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: xylB (D-xylulose kinase XylB), medium confidence from genomic context alone (score 532 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1023 eno |
enolase | 646 | 630 | database:597 |
Rv2971 |
oxidoreductase | 652 | 606 | coexpression:419 |
Rv3579c rlmB |
23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB | 549 | 549 | database:546 |
Rv1644 tsnR |
23S rRNA methyltransferase TsnR | 548 | 548 | database:546 |
Rv0881 |
tRNA/rRNA methyltransferase | 546 | 547 | database:546 |
Rv0380c |
RNA methyltransferase | 546 | 547 | database:546 |
Rv0729 xylB |
D-xylulose kinase XylB | 571 | 532 ctx | cooccurence:483 |
Rv2970A hyp |
hypothetical protein | 570 | 513 | coexpression:417 |
Rv3696c glpK |
glycerol kinase | 655 | 498 | |
Rv1371 |
membrane protein | 514 | 495 | experimental:474 |
Rv2297 hyp |
hypothetical protein | 481 | 481 ctx | neighborhood:466 |
Rv0018c pstP |
phosphoserine/threonine phosphatase PstP | 480 | 481 | experimental:474 |
Rv2296 dhmA1 |
haloalkane dehalogenase | 490 | 470 ctx | neighborhood:417 |
Rv0009 ppiA |
iron-regulated peptidyl-prolyl cis-trans isomerase PpiA | 484 | 465 | experimental:463 |
Rv2582 ppiB |
peptidyl-prolyl cis-trans isomerase B | 483 | 464 | experimental:463 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: oxidoreductase
- MTBC0 PGAP product: aldo/keto reductase
- Pfam (hmmscan --cut_ga): Aldo_ket_red PF00248.28 (E=1e-55)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216814.1)
- Domains: Pfam-A via hmmscan --cut_ga — Aldo_ket_red (PF00248.28)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0667 - Curated reference: UniProt P9WQA7 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
82 functional partner(s); context anchor
xylB - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002438|Rv2298| MKYLDVDGIGQVSRIGLGTWQFGSREWGYGDRYATGAARDIVKRARALGVTLFDTAEIYGLGKSERILGEALGDDRTEVVVASKVFPVAPFPAVIKNRERASARRLQLNRIPLYQIHQPNPVVPDSVIMPGMRDLLDSGDIGAAGVSNYSLARWRKADAALGRPVVSNQVHFSLAHPDALEDLVPFAELENRIVIAYSPLAQGLLGGKYGLENRPGGVRALNPLFGTENLRRIEPLLATLRAIAVDVDAKPAQVALAWLISLPGVVAIPGASSVEQLEFNVAAADIELSAQSRDALTDAARAFRPVSTGRFLTDMVREKVSRR