Rv0760c Family assigned · medium auto-curated

H37Rv Rv0760c · MTBC0 mtbc0_000809 · 139 aa · 858691–859110 (-) · RefSeq NP_215274.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationketosteroid isomerase family protein
Revised (this work)Ketosteroid isomerase family protein. Pfam: NTF2 (PF02136.27), SnoaL_2 (PF12680.14).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6WZD7 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionnuclear transport factor 2
Orthologous groupCOG3631
EC number EC 5.3.3.1
KEGG orthology K01822
KEGG pathways map00140, map00984, map01100, map01120
KEGG modules M00107, M00110

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.442 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 1 nonsense, 0 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 4.45% of strains (6460) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
NTF2PF02136.27 1.5e-1412–135 Nuclear transport factor 2 (NTF2) domain
SnoaL_2PF12680.14 1.7e-1018–123 SnoaL-like domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: adhB (alcohol dehydrogenase B), high confidence from genomic context alone (score 973 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0761c adhB alcohol dehydrogenase B 973 973 ctx neighborhood:874 coexpression:797
Rv1817 flavoprotein 947 946 ctx cooccurence:476 database:900
Rv3537 kstD 3-oxosteroid 1-dehydrogenase 940 938 ctx cooccurence:404 database:900
Rv0763c ferredoxin 832 832 ctx neighborhood:769
Rv2299c htpG chaperone protein HtpG 785 785 coexpression:785
Rv0310c hyp hypothetical protein 740 741 ctx cooccurence:720
Rv3526 kshA 3-ketosteroid-9-alpha-monooxygenase oxygenase subunit 736 736 ctx cooccurence:728
Rv3541c chsH1 hyp hypothetical protein 727 728 ctx cooccurence:727
Rv3521 hyp hypothetical protein 722 722 ctx cooccurence:721
Rv0762c hyp hypothetical protein 720 720 ctx neighborhood:578
Rv3568c hsaC extradiol dioxygenase 712 713 ctx cooccurence:703
Rv3527 hyp hypothetical protein 703 703 ctx cooccurence:702
Rv3522 ltp4 lipid transfer protein 690 691 ctx cooccurence:690
Rv3542c chsH2 hyp hypothetical protein 682 682 ctx cooccurence:681
Rv3552 CoA-transferase subunit beta 682 682 ctx cooccurence:682

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: ketosteroid isomerase family protein
  • Pfam (hmmscan --cut_ga): NTF2 PF02136.27 (E=1e-14), SnoaL_2 PF12680.14 (E=2e-10)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215274.1)
  • Domains: Pfam-A via hmmscan --cut_ga — NTF2 (PF02136.27), SnoaL_2 (PF12680.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3631
  • Curated reference: UniProt I6WZD7 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 51 functional partner(s); context anchor adhB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000809|Rv0760c|
MTQTTQSPALIASQSSWRCVQAHDREGWLALMADDVVIEDPIGKSVTNPDGSGIKGKEAVGAFFDTHIAANRLTVTCEETFPSSSPDEIAHILVLHSEFDGGFTSEVRGVFTYRVNKAGLITNMRGYWNLDMMTFGNQE