rpfE Resolved · high auto-curated

H37Rv Rv2450c · MTBC0 mtbc0_002609 · 172 aa · 2775910–2776428 (-) · RefSeq NP_216966.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)resuscitation-promoting factor RpfE
MTBC0 PGAP re-annotationresuscitation-promoting factor protein RpfE
Revised (this work)Resuscitation-promoting factor protein RpfE. Pfam: Transglycosylas (PF06737.20).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53177 SwissProt · reviewed · Evidence at protein level
UniProt nameResuscitation-promoting factor RpfE
EC (curated) EC 3.-.-.-
Curated functionFactor that stimulates resuscitation of dormant cells. Has peptidoglycan (PG) hydrolytic activity. Active in the pM concentration range. Has little to no effect on actively-growing cells. PG fragments could either directly activate the resuscitation pathway of dormant bacteria or serve as a substrate for endogenous Rpf, resulting in low molecular weight products with resuscitation activity..; FUNCTION: Stimulates growth of stationary phase M.bovis (a slow-growing Mycobacterium), reduces the lag phase of diluted fast-growers M.smegmatis and Micrococcus luteus. Sequential gene disruption indicat.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category M Cell wall / membrane / envelope biogenesis
Preferred namerpfE
eggNOG descriptionTransglycosylase-like domain
Orthologous groupCOG1388
KEGG orthology K21687, K21691
CAZy family GH23
Gene Ontology (20) GO:0005575, GO:0005576, GO:0008150, GO:0009892, GO:0009893, GO:0010468, GO:0010604, GO:0010605, GO:0010628, GO:0010629, GO:0019222, GO:0040008 +8 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.083 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
TransglycosylasPF06737.20 1.1e-3496–168 Transglycosylase-like domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2449c (trans-acting enoyl reductase), medium confidence from genomic context alone (score 659 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1954A Rv1954A, len: 100 aa. Hypothetical unknown protein. 881 881 coexpression:490 experimental:769
Rv2449c trans-acting enoyl reductase 659 659 ctx neighborhood:596
Rv2451 hyp hypothetical protein 564 563 ctx neighborhood:559
Rv0007 membrane protein 498 498 coexpression:498
Rv3268 hyp hypothetical protein 468 468 ctx cooccurence:468
Rv2286c hyp hypothetical protein 444 444 ctx cooccurence:444
Rv0925c hyp hypothetical protein 466 441 coexpression:440
Rv3669 transmembrane protein 440 440
Rv2771c hyp hypothetical protein 464 439 coexpression:438
Rv2448c valS valine--tRNA ligase 438 438 ctx neighborhood:429
Rv2466c hyp hypothetical protein 431 431 ctx cooccurence:429
Rv2006 otsB1 trehalose-6-phosphate phosphatase OtsB 460 427 coexpression:417
Rv3372 otsB2 trehalose 6-phosphate phosphatase 459 426 coexpression:418
Rv2447c folC folylpolyglutamate synthase FolC 420 420 ctx neighborhood:416
Rv2446c integral membrane protein 419 419 ctx neighborhood:416

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: resuscitation-promoting factor RpfE
  • MTBC0 PGAP product: resuscitation-promoting factor protein RpfE
  • Pfam (hmmscan --cut_ga): Transglycosylas PF06737.20 (E=1e-34)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216966.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Transglycosylas (PF06737.20)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1388
  • Curated reference: UniProt O53177 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 26 functional partner(s); context anchor Rv2449c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002609|Rv2450c|rpfE
MKNARTTLIAAAIAGTLVTTSPAGIANADDAGLDPNAAAGPDAVGFDPNLPPAPDAAPVDTPPAPEDAGFDPNLPPPLAPDFLSPPAEEAPPVPVAYSVNWDAIAQCESGGNWSINTGNGYYGGLQFTAGTWRANGGSGSAANASREEQIRVAENVLRSQGIRAWPVCGRRG