rpfE Resolved · high auto-curated

H37Rv Rv2450c · MTBC0 mtbc0_002609 · 172 aa · 2775910–2776428 MTBC0 (-) · RefSeq NP_216966.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand rpmA (Rv2441c) — requalified: 50S ribosomal protein L27 rplU (Rv2442c) — requalified: 50S ribosomal protein L21 dctA (Rv2443) — family_assigned: cation:dicarboxylase symporter family transporter dctA rne (Rv2444c) — family_assigned: Rne/Rng family ribonuclease rne ndkA (Rv2445c) — requalified: nucleoside-diphosphate kinase Rv2446c (Rv2446c) — dark: DUF4233 domain-containing protein folC (Rv2447c) — requalified: bifunctional tetrahydrofolate synthase/dihydrofolate synthas folC Rv2449c (Rv2449c) — family_assigned: trans-acting enoyl reductase family protein Rv2449c rpfE (Rv2450c) — requalified: resuscitation-promoting factor protein RpfE Rv2451 (Rv2451) — dark: hypothetical protein Rv2452c (Rv2452c) — dark: hypothetical protein mobA (Rv2453c) — requalified: molybdenum cofactor guanylyltransferase Rv2454c (Rv2454c) — family_assigned: 2-oxoacid:ferredoxin oxidoreductase subunit beta Rv2454c Rv2455c (Rv2455c) — family_assigned: 2-oxoacid:acceptor oxidoreductase subunit alpha Rv2455c Rv2456c (Rv2456c) — requalified: MFS transporter Rv2456c clpX (Rv2457c) — family_assigned: ATP-dependent Clp protease ATP-binding subunit ClpX clpX mmuM (Rv2458) — requalified: homocysteine S-methyltransferase mmuM jefA (Rv2459) — requalified: multidrug efflux pump JefA jefA clpP2 (Rv2460c) — family_assigned: ATP-dependent CLP protease proteolytic subunit ClpP2 tig (Rv2462c) — requalified: trigger factor 2 768 kb 2 772 kb 2 776 kb 2 780 kb 2 784 kb 2 788 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)resuscitation-promoting factor RpfE
MTBC0 PGAP re-annotationresuscitation-promoting factor protein RpfE
Revised (this work)Resuscitation-promoting factor protein RpfE. Pfam: Transglycosylas (PF06737.20).
Functional category (TubercuList)cell wall and cell processes

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 35 publications

35 TB publications mention this gene. 35 publication(s) discuss this gene (35 in a M. tuberculosis context, 5 in other mycobacteria — M. smegmatis (3), M. marinum (2)).

Most recent 5 of 35.
PublicationDate
Enhanced immunogenicity in mouse by recombinant BCG prime and protein boost based on latency antigen Rv1733c and/or reactivation antigen RpfE. doi:10.1186/s12879-025-11534-w 2025
Immunoinformatics design and experimental expression of a multi-epitope vaccine simultaneously targeting AAV2 and HAdV-F41 against acute hepatitis of unknown etiology. doi:10.1016/j.virol.2025.110653 2025
Immunoinformatic development of a multiepitope messenger RNA vaccine targeting lipoate protein ligase and dihydrolipoamide dehydrogenase proteins of Mycoplasma bovis in cattle. doi:10.14202/vetworld.2025.1675-1684 2025
Multiepitope mRNA Vaccine mRNA-mEp21-FL-IDT Provides Efficient Protection against M. tuberculosis. doi:10.1134/S0006297925600073 2025
Discovery of novel vaccine candidates based on the immunogenic epitopes derived from Toxoplasma membrane proteins. doi:10.7774/cevr.2025.14.e4 2025

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Intrinsic disorder (sequence + structure) highly disordered

Predicted disorder52% of residues (metapredict) · mean AlphaFold pLDDT 74.7
Disordered regions1 IDR(s), longest 89 aa [0-89]

sequence-based disorder is high but AlphaFold folds it confidently (pLDDT>=70): treat the disorder call with caution (possible metapredict over-call)

A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).

Conditional expression context (iModulons)

Member of 1 independently-modulated gene set(s): Fumarate Reductase.

iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).

CRISPRi vulnerability

Vulnerability index -0.12 (95% CI -1.15 to 1.14). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionThought to promote the resuscitation and growth of dormant, nongrowing cells. Could also stimulate the growth of several other high G+C gram+ organisms, e.g. Mycobacterium avium, Mycobacterium bovis (BCG), Mycobacterium kansasii, Mycobacterium smegmatis.

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb2477c · 98.8% identity
M. marinum MMAR_3776 · 87.3% identity
M. smegmatis MSMEG_4643 · 79.2% identity
M. orygis RJtmp_002533 · 98.8% identity
M. abscessus MAB_1597 · 85.1% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt O53177 SwissProt · reviewed · Evidence at protein level
UniProt nameResuscitation-promoting factor RpfE
EC (curated) EC 3.-.-.-
Curated functionFactor that stimulates resuscitation of dormant cells. Has peptidoglycan (PG) hydrolytic activity. Active in the pM concentration range. Has little to no effect on actively-growing cells. PG fragments could either directly activate the resuscitation pathway of dormant bacteria or serve as a substrate for endogenous Rpf, resulting in low molecular weight products with resuscitation activity..; FUNCTION: Stimulates growth of stationary phase M.bovis (a slow-growing Mycobacterium), reduces the lag phase of diluted fast-growers M.smegmatis and Micrococcus luteus. Sequential gene disruption indicat.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category M Cell wall / membrane / envelope biogenesis
Preferred namerpfE
eggNOG descriptionTransglycosylase-like domain
Orthologous groupCOG1388
KEGG orthology K21687, K21691
CAZy family GH23
Gene Ontology (20) GO:0005575, GO:0005576, GO:0008150, GO:0009892, GO:0009893, GO:0010468, GO:0010604, GO:0010605, GO:0010628, GO:0010629, GO:0019222, GO:0040008 +8 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.083 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Mycobacterium

M. canettii dN/dS (deep-divergence selection) 0.181 (low power) · 3 consensus substitution(s)
low power (3 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 5/53 (9%) · mean identity 64.3% · 1/4 closest MTBAP relatives
present in a subset of the genus (5/53 NTM; in 1 of the 4 closest MTBAP relatives) — partial/intermediate conservation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria

present across the genus Mycobacterium (NTM) but not detected in any non-Mycobacterium genome — a Mycobacterium-genus gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 8 in the ORF — 0 in the essential state, 0 growth-defect, 8 non-essential, 0 growth-advantage. Saturation 0.875, mean read count 74.2857142857. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
CaveatRead with some caution: only 8 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 8 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3)

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype

Conditionlog2FCqEffect
fitness in mouse infection (in vivo) -1.100.0042 required

Conditional fitness of transposon-disruption mutants across 1 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.

Proteomics (mass spectrometry) detected

MS detectiondetected in 5 of 16 independent MS datasets
Integrated abundance1.47 ppm · rank 3221/3519 (8.5th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Predicted localisation (DeepTMHMM + lipobox) signal peptide

Predictionpredicted secreted protein (signal peptide)
DeepTMHMM classSP

Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.

Physico-chemical properties (computed, ProtParam)

Length172 aa
Molecular weight17.4 kDa
Theoretical pI4.22
GRAVY-0.263 (hydrophilic)
Aliphatic index69.5
Aromaticity0.064
Instability index48.2 (unstable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
TransglycosylasPF06737.20 1.1e-3496–168 Transglycosylase-like domain

Experimental structures (Protein Data Bank) 1 solved

PDBMethodResolutionCoverage
4cge X-ray diffraction 2.756 Å 52%

Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (1 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 74.7

PDB hitprobTM-scoreE-valueDescription
4cge-assembly1_A 1.00 0.99 3.0e-12 sig 4cge-assembly1_A Crystal structure of Mycobacterium tuberculosis Resuscitation promoting factor E
4cge-assembly2_B 1.00 0.98 9.1e-11 sig 4cge-assembly2_B Crystal structure of Mycobacterium tuberculosis Resuscitation promoting factor E
4cge-assembly6_F 1.00 0.95 7.1e-11 sig 4cge-assembly6_F Crystal structure of Mycobacterium tuberculosis Resuscitation promoting factor E
4ow1-assembly2_B 1.00 0.99 2.1e-09 sig 4ow1-assembly2_B Crystal Structure of Resuscitation Promoting Factor C
4ow1-assembly1_A 1.00 0.97 3.7e-09 sig 4ow1-assembly1_A Crystal Structure of Resuscitation Promoting Factor C

Foldseek search of the AlphaFold DB model (mean pLDDT 74.7, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon)

Upstream (5' on genome)Rv2449c (- strand, 89 bp gap)
Downstream (3' on genome)Rv2451 (+ strand, 81 bp gap)

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: Rv2449c (trans-acting enoyl reductase), medium confidence from genomic context alone (score 659 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1954A exp Rv1954A, len: 100 aa. Hypothetical unknown protein. 881 881 coexpression:490 experimental:769
Rv2449c trans-acting enoyl reductase 659 659 ctx neighborhood:596
Rv2451 hyp hypothetical protein 564 563 ctx neighborhood:559
Rv0007 membrane protein 498 498 coexpression:498
Rv3268 hyp hypothetical protein 468 468 ctx cooccurence:468
Rv2286c hyp hypothetical protein 444 444 ctx cooccurence:444
Rv0925c hyp hypothetical protein 466 441 coexpression:440
Rv3669 transmembrane protein 440 440
Rv2771c hyp hypothetical protein 464 439 coexpression:438
Rv2448c valS valine--tRNA ligase 438 438 ctx neighborhood:429
Rv2466c hyp hypothetical protein 431 431 ctx cooccurence:429
Rv2006 otsB1 trehalose-6-phosphate phosphatase OtsB 460 427 coexpression:417
Rv3372 otsB2 trehalose 6-phosphate phosphatase 459 426 coexpression:418
Rv2447c folC folylpolyglutamate synthase FolC 420 420 ctx neighborhood:416
Rv2446c integral membrane protein 419 419 ctx neighborhood:416

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: resuscitation-promoting factor RpfE
  • MTBC0 PGAP product: resuscitation-promoting factor protein RpfE
  • Pfam (hmmscan --cut_ga): Transglycosylas PF06737.20 (E=1e-34)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216966.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Transglycosylas (PF06737.20)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1388
  • Curated reference: UniProt O53177 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 74.7)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 26 functional partner(s); context anchor Rv2449c
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002609|Rv2450c|rpfE
MKNARTTLIAAAIAGTLVTTSPAGIANADDAGLDPNAAAGPDAVGFDPNLPPAPDAAPVDTPPAPEDAGFDPNLPPPLAPDFLSPPAEEAPPVPVAYSVNWDAIAQCESGGNWSINTGNGYYGGLQFTAGTWRANGGSGSAANASREEQIRVAENVLRSQGIRAWPVCGRRG