mshB Resolved · high auto-curated
H37Rv Rv1170 · MTBC0 mtbc0_001259 ·
303 aa · 1308745–1309656 (+) ·
RefSeq NP_215686.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | 1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase |
|---|---|
| MTBC0 PGAP re-annotation | N-acetyl-1-D-myo-inositol-2-amino-2-deoxy-alpha-D-glucopyranoside deacetylase |
| Revised (this work) | N-acetyl-1-D-myo-inositol-2-amino-2-deoxy-alpha-D-glucopyranoside deacetylase. Pfam: PIG-L (PF02585.23). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WJN3
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | 1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase |
| EC (curated) |
EC 3.5.1.103
|
| Curated function | Catalyzes the deacetylation of 1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside (GlcNAc-Ins) in the mycothiol (MSH) biosynthesis pathway. Shows some amidase activity toward S-conjugates of mycothiol. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| Preferred name | mshB |
| eggNOG description | Catalyzes the deacetylation of 1D-myo-inositol 2- acetamido-2-deoxy-alpha-D-glucopyranoside (GlcNAc-Ins) in the mycothiol biosynthesis pathway |
| Orthologous group | COG2120 |
| EC number |
EC 3.5.1.103
|
| KEGG orthology |
K15525
|
| Gene Ontology (37) |
GO:0003674, GO:0003824, GO:0005488, GO:0005575, GO:0005623, GO:0005886, GO:0006790, GO:0008150, GO:0008152, GO:0008270, GO:0009058, GO:0009987 +25 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.545 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
PIG-L | PF02585.23 | 1.2e-31 | 8–157 | GlcNAc-PI de-N-acetylase |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: mshA (D-inositol 3-phosphate glycosyltransferase), high confidence from genomic context alone (score 797 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0486 mshA |
D-inositol 3-phosphate glycosyltransferase | 986 | 797 ctx | fusion:471 cooccurence:602 textmining:935 |
Rv1171 hyp |
hypothetical protein | 778 | 778 ctx | neighborhood:777 |
Rv2466c hyp |
hypothetical protein | 752 | 752 ctx | cooccurence:740 |
Rv2130c mshC |
cysteine:1D-myo-inosityl 2-amino-2-deoxy--D-glucopyranoside ligase | 986 | 704 | database:500 textmining:955 |
Rv0819 mshD |
mycothiol acetyltransferase | 984 | 694 ctx | cooccurence:691 textmining:953 |
Rv2133c hyp |
hypothetical protein | 641 | 642 ctx | cooccurence:640 |
Rv2134c hyp |
hypothetical protein | 615 | 615 ctx | cooccurence:613 |
Rv0360c hyp |
hypothetical protein | 601 | 601 ctx | cooccurence:601 |
Rv1168c PPE17 |
PPE family protein PPE17 | 599 | 599 ctx | neighborhood:498 |
Rv1169c lipX |
lipase LipX | 662 | 523 ctx | neighborhood:523 |
Rv2286c hyp |
hypothetical protein | 483 | 483 ctx | cooccurence:483 |
Rv3198A |
glutaredoxin protein | 609 | 480 ctx | cooccurence:477 |
Rv1082 mca |
mycothiol S-conjugate amidase | 527 | 300 | |
Rv1406 fmt |
methionyl-tRNA formyltransferase | 526 | 196 | textmining:435 |
Rv0871 cspB |
cold shock-like protein CspB | 442 | 57 | textmining:433 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: 1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase
- MTBC0 PGAP product: N-acetyl-1-D-myo-inositol-2-amino-2-deoxy-alpha-D-glucopyranoside deacetylase
- Pfam (hmmscan --cut_ga): PIG-L PF02585.23 (E=1e-31)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215686.1)
- Domains: Pfam-A via hmmscan --cut_ga — PIG-L (PF02585.23)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2120 - Curated reference: UniProt P9WJN3 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
28 functional partner(s); context anchor
mshA - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001259|Rv1170|mshB MSETPRLLFVHAHPDDESLSNGATIAHYTSRGAQVHVVTCTLGEEGEVIGDRWAQLTADHADQLGGYRIGELTAALRALGVSAPIYLGGAGRWRDSGMAGTDQRSQRRFVDADPRQTVGALVAIIRELRPHVVVTYDPNGGYGHPDHVHTHTVTTAAVAAAGVGSGTADHPGDPWTVPKFYWTVLGLSALISGARALVPDDLRPEWVLPRADEIAFGYSDDGIDAVVEADEQARAAKVAALAAHATQVVVGPTGRAAALSNNLALPILADEHYVLAGGSAGARDERGWETDLLAGLGFTASGT