mshB Resolved · high auto-curated

H37Rv Rv1170 · MTBC0 mtbc0_001259 · 303 aa · 1308745–1309656 (+) · RefSeq NP_215686.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase
MTBC0 PGAP re-annotationN-acetyl-1-D-myo-inositol-2-amino-2-deoxy-alpha-D-glucopyranoside deacetylase
Revised (this work)N-acetyl-1-D-myo-inositol-2-amino-2-deoxy-alpha-D-glucopyranoside deacetylase. Pfam: PIG-L (PF02585.23).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WJN3 SwissProt · reviewed · Evidence at protein level
UniProt name1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase
EC (curated) EC 3.5.1.103
Curated functionCatalyzes the deacetylation of 1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside (GlcNAc-Ins) in the mycothiol (MSH) biosynthesis pathway. Shows some amidase activity toward S-conjugates of mycothiol.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namemshB
eggNOG descriptionCatalyzes the deacetylation of 1D-myo-inositol 2- acetamido-2-deoxy-alpha-D-glucopyranoside (GlcNAc-Ins) in the mycothiol biosynthesis pathway
Orthologous groupCOG2120
EC number EC 3.5.1.103
KEGG orthology K15525
Gene Ontology (37) GO:0003674, GO:0003824, GO:0005488, GO:0005575, GO:0005623, GO:0005886, GO:0006790, GO:0008150, GO:0008152, GO:0008270, GO:0009058, GO:0009987 +25 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.545 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PIG-LPF02585.23 1.2e-318–157 GlcNAc-PI de-N-acetylase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mshA (D-inositol 3-phosphate glycosyltransferase), high confidence from genomic context alone (score 797 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0486 mshA D-inositol 3-phosphate glycosyltransferase 986 797 ctx fusion:471 cooccurence:602 textmining:935
Rv1171 hyp hypothetical protein 778 778 ctx neighborhood:777
Rv2466c hyp hypothetical protein 752 752 ctx cooccurence:740
Rv2130c mshC cysteine:1D-myo-inosityl 2-amino-2-deoxy--D-glucopyranoside ligase 986 704 database:500 textmining:955
Rv0819 mshD mycothiol acetyltransferase 984 694 ctx cooccurence:691 textmining:953
Rv2133c hyp hypothetical protein 641 642 ctx cooccurence:640
Rv2134c hyp hypothetical protein 615 615 ctx cooccurence:613
Rv0360c hyp hypothetical protein 601 601 ctx cooccurence:601
Rv1168c PPE17 PPE family protein PPE17 599 599 ctx neighborhood:498
Rv1169c lipX lipase LipX 662 523 ctx neighborhood:523
Rv2286c hyp hypothetical protein 483 483 ctx cooccurence:483
Rv3198A glutaredoxin protein 609 480 ctx cooccurence:477
Rv1082 mca mycothiol S-conjugate amidase 527 300
Rv1406 fmt methionyl-tRNA formyltransferase 526 196 textmining:435
Rv0871 cspB cold shock-like protein CspB 442 57 textmining:433

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase
  • MTBC0 PGAP product: N-acetyl-1-D-myo-inositol-2-amino-2-deoxy-alpha-D-glucopyranoside deacetylase
  • Pfam (hmmscan --cut_ga): PIG-L PF02585.23 (E=1e-31)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215686.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PIG-L (PF02585.23)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2120
  • Curated reference: UniProt P9WJN3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 28 functional partner(s); context anchor mshA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001259|Rv1170|mshB
MSETPRLLFVHAHPDDESLSNGATIAHYTSRGAQVHVVTCTLGEEGEVIGDRWAQLTADHADQLGGYRIGELTAALRALGVSAPIYLGGAGRWRDSGMAGTDQRSQRRFVDADPRQTVGALVAIIRELRPHVVVTYDPNGGYGHPDHVHTHTVTTAAVAAAGVGSGTADHPGDPWTVPKFYWTVLGLSALISGARALVPDDLRPEWVLPRADEIAFGYSDDGIDAVVEADEQARAAKVAALAAHATQVVVGPTGRAAALSNNLALPILADEHYVLAGGSAGARDERGWETDLLAGLGFTASGT