Rv2272 Family assigned · low auto-curated

H37Rv Rv2272 · MTBC0 mtbc0_002414 · 122 aa · 2571842–2572210 (+) · RefSeq NP_216788.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transmembrane protein
MTBC0 PGAP re-annotationYidH family protein
Revised (this work)YidH family protein.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WLF5 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv2272

UniProt still lists this protein as Uncharacterized protein Rv2272; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionDomain of unknown function (DUF202)
Orthologous groupCOG2149
KEGG orthology K00389

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF202PF02656.21 3.4e-1917–83 Domain of unknown function (DUF202)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2273 (transmembrane protein), high confidence from genomic context alone (score 896 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2273 transmembrane protein 985 896 ctx neighborhood:882 textmining:870
Rv2271 hyp hypothetical protein 546 546 ctx neighborhood:534
Rv3066 DeoR family transcriptional regulator 441 441 ctx cooccurence:441
Rv2270 lppN lipoprotein LppN 415 416 ctx neighborhood:412
Rv2779c Lrp/AsnC family transcriptional regulator 692 152 textmining:652
Rv3777 oxidoreductase 810 78 textmining:803
Rv2243 fabD malonyl CoA-acyl carrier protein transacylase 512 46 textmining:510
Rv3549c short-chain type dehydrogenase/reductase 440 41 textmining:440

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transmembrane protein
  • MTBC0 PGAP product: YidH family protein
  • Pfam (hmmscan --cut_ga): DUF202 PF02656.21 (E=3e-19)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216788.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF202 (PF02656.21)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2149
  • Curated reference: UniProt P9WLF5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 8 functional partner(s); context anchor Rv2273
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002414|Rv2272|
MADDSNDTATDVEPDYRFTLANERTFLAWQRTALGLLAAAVALVQLVPELTIPGARQVLGVVLAILAILTSGMGLLRWQQADRAMRRHLPLPRHPTPGYLAVGLCVVGVVALALVVAKAITG