pyrF Resolved · high auto-curated

H37Rv Rv1385 · MTBC0 mtbc0_001486 · 274 aa · 1569789–1570613 (+) · RefSeq NP_215901.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)orotidine 5'-phosphate decarboxylase
MTBC0 PGAP re-annotationorotidine-5'-phosphate decarboxylase
Revised (this work)Orotidine-5'-phosphate decarboxylase. Pfam: OMPdecase (PF00215.31).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WIU3 SwissProt · reviewed · Evidence at protein level
UniProt nameOrotidine 5'-phosphate decarboxylase
EC (curated) EC 4.1.1.23

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category F Nucleotide transport and metabolism
Preferred namepyrF
eggNOG descriptionBelongs to the OMP decarboxylase family. Type 2 subfamily
Orthologous groupCOG0284
EC number EC 4.1.1.23
KEGG orthology K01591
KEGG pathways map00240, map01100
KEGG modules M00051

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.132 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
OMPdecasePF00215.31 4.3e-4017–259 Orotidine 5'-phosphate decarboxylase / HUMPS family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: carB (carbamoyl-phosphate synthase large subunit), high confidence from genomic context alone (score 997 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1384 carB carbamoyl-phosphate synthase large subunit 998 997 ctx neighborhood:881 fusion:653 coexpression:918 textmining:419
Rv1379 pyrR bifunctional pyrimidine operon regulatory protein/uracil phosphoribosyltransferase 997 997 ctx neighborhood:881 coexpression:776 database:900
Rv1383 carA carbamoyl-phosphate synthase small subunit 989 988 ctx neighborhood:881 coexpression:864
Rv1381 pyrC dihydroorotase 991 987 ctx neighborhood:881 coexpression:863
Rv1380 pyrB aspartate carbamoyltransferase 992 983 ctx neighborhood:881 coexpression:859 textmining:588
Rv0382c pyrE orotate phosphoribosyltransferase 993 979 coexpression:734 database:900 textmining:697
Rv1382 hyp hypothetical protein 974 971 ctx neighborhood:881 coexpression:764
Rv3309c upp uracil phosphoribosyltransferase 996 930 database:900 textmining:951
Rv2883c pyrH uridylate kinase 945 909 database:900 textmining:431
Rv2139 pyrD dihydroorotate dehydrogenase 945 881 coexpression:861 textmining:563
Rv1937 oxygenase 819 780 coexpression:731
Rv0385 monooxygenase 792 779 coexpression:733
Rv0383c ttfA hyp hypothetical protein 822 751 coexpression:730
Rv1389 gmk guanylate kinase 775 739 ctx fusion:517
Rv1377c transferase 619 619 ctx neighborhood:614

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: orotidine 5'-phosphate decarboxylase
  • MTBC0 PGAP product: orotidine-5'-phosphate decarboxylase
  • Pfam (hmmscan --cut_ga): OMPdecase PF00215.31 (E=4e-40)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215901.1)
  • Domains: Pfam-A via hmmscan --cut_ga — OMPdecase (PF00215.31)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0284
  • Curated reference: UniProt P9WIU3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 85 functional partner(s); context anchor carB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001486|Rv1385|pyrF
MTGFGLRLAEAKARRGPLCLGIDPHPELLRGWDLATTADGLAAFCDICVRAFADFAVVKPQVAFFESYGAAGFAVLERTIAELRAADVLVLADAKRGDIGATMSAYATAWVGDSPLAADAVTASPYLGFGSLRPLLEVAAAHGRGVFVLAATSNPEGAAVQNAAADGRSVAQLVVDQVGAANEAAGPGPGSIGVVVGATAPQAPDLSAFTGPVLVPGVGVQGGRPEALGGLGGAASSQLLPAVAREVLRAGPGVPELRAAGERMRDAVAYLAAV