pyrE Resolved · high auto-curated

H37Rv Rv0382c · MTBC0 - · 179 aa · 457841–458380 (-) · RefSeq YP_177723.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)orotate phosphoribosyltransferase
MTBC0 PGAP re-annotation
Revised (this work)Orotate phosphoribosyltransferase. Pfam: Pribosyltran (PF00156.34).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WHK9 SwissProt · reviewed · Evidence at protein level
UniProt nameOrotate phosphoribosyltransferase
EC (curated) EC 2.4.2.10
Curated functionCatalyzes the transfer of a ribosyl phosphate group from 5-phosphoribose 1-diphosphate to orotate, leading to the formation of orotidine monophosphate (OMP).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category F Nucleotide transport and metabolism
Preferred namepyrE
eggNOG descriptionCatalyzes the transfer of a ribosyl phosphate group from 5-phosphoribose 1-diphosphate to orotate, leading to the formation of orotidine monophosphate (OMP)
Orthologous groupCOG0461
EC number EC 2.4.2.10
KEGG orthology K00762
KEGG pathways map00240, map01100
KEGG modules M00051

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.388 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PribosyltranPF00156.34 1.6e-08107–157 Phosphoribosyl transferase domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0380c (RNA methyltransferase), high confidence from genomic context alone (score 776 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1385 pyrF orotidine 5'-phosphate decarboxylase 993 979 coexpression:734 database:900 textmining:697
Rv2139 pyrD dihydroorotate dehydrogenase 990 979 coexpression:734 database:900 textmining:590
Rv0381c hyp hypothetical protein 867 867 ctx neighborhood:863
Rv1381 pyrC dihydroorotase 912 827 coexpression:731 textmining:518
Rv1384 carB carbamoyl-phosphate synthase large subunit 841 818 coexpression:732
Rv1017c prsA ribose-phosphate pyrophosphokinase 885 816 database:800 textmining:403
Rv1383 carA carbamoyl-phosphate synthase small subunit 826 800 coexpression:730
Rv0383c ttfA hyp hypothetical protein 785 786 ctx neighborhood:786
Rv0380c RNA methyltransferase 775 776 ctx neighborhood:765
Rv0385 monooxygenase 790 770 coexpression:671
Rv1380 pyrB aspartate carbamoyltransferase 895 761 coexpression:730 textmining:580
Rv1937 oxygenase 800 730 coexpression:715
Rv1379 pyrR bifunctional pyrimidine operon regulatory protein/uracil phosphoribosyltransferase 819 713 coexpression:697
Rv0384c clpB chaperone protein ClpB 762 702 ctx neighborhood:699
Rv1382 hyp hypothetical protein 707 681 coexpression:670

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): orotate phosphoribosyltransferase
  • Pfam (hmmscan --cut_ga): Pribosyltran PF00156.34 (E=2e-08)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177723.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Pribosyltran (PF00156.34)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0461
  • Curated reference: UniProt P9WHK9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 54 functional partner(s); context anchor Rv0380c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0382c|pyrE
MAGPDRAELAELVRRLSVVHGRVTLSSGREADYYVDLRRATLHHRASALIGRLMRELTADWDYSVVGGLTLGADPVATAIMHAPGRPIDAFVVRKSAKAHGMQRLIEGSEVTGQRVLVVEDTSTTGNSALTAVHAVQDVGGEVVGVATVVDRATGAAEAIEAEGLRYRSVLGLADLGLD