pyrE Resolved · high auto-curated
H37Rv Rv0382c · MTBC0 - ·
179 aa ·
457841–458380 H37Rv
(-) ·
RefSeq YP_177723.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | orotate phosphoribosyltransferase |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Orotate phosphoribosyltransferase. Pfam: Pribosyltran (PF00156.34). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
In the literature (TB corpus sweep) 3 publications
3 TB publications mention this gene. 3 publication(s) discuss this gene (2 in a M. tuberculosis context, 1 in other mycobacteria — M. smegmatis (1)).
| Publication | Date |
|---|---|
| Characterization of Pyridomycin B Reveals the Formation of Functional Groups in Antimycobacterial Pyridomycin. doi:10.1128/AEM.02035-21 | 2022 |
| Molecular, kinetic and thermodynamic characterization of Mycobacterium tuberculosis orotate phosphoribosyltransferase. doi:10.1039/c1mb05402c | 2012 |
| Regulation of pyrimidine biosynthetic gene expression in bacteria: repression without repressors. doi:10.1128/MMBR.00001-08 | 2008 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index -10.45 (95% CI -12.82 to -8.13). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in pyrimidine biosynthesis (at the fifth step) [catalytic activity: orotidine 5'-phosphate + diphosphate = orotate + 5-phospho-alpha-D-ribose 1-diphosphate]. |
|---|---|
| Mycobrowser EC |
2.4.2.10
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb0389c
· 99.4% identity |
|---|---|
| M. leprae |
ML2487c
· 85.4% identity |
| M. marinum |
MMAR_0649
· 88.2% identity |
| M. smegmatis |
MSMEG_6520
· 32.9% identity |
| M. orygis |
RJtmp_000399
· 99.4% identity |
| M. abscessus |
MAB_4260c
· 83.9% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WHK9
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Orotate phosphoribosyltransferase |
| EC (curated) |
EC 2.4.2.10
|
| Curated function | Catalyzes the transfer of a ribosyl phosphate group from 5-phosphoribose 1-diphosphate to orotate, leading to the formation of orotidine monophosphate (OMP). |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
F Nucleotide transport and metabolism
|
|---|---|
| Preferred name | pyrE |
| eggNOG description | Catalyzes the transfer of a ribosyl phosphate group from 5-phosphoribose 1-diphosphate to orotate, leading to the formation of orotidine monophosphate (OMP) |
| Orthologous group | COG0461 |
| EC number |
EC 2.4.2.10
|
| KEGG orthology |
K00762
|
| KEGG pathways |
map00240, map01100
|
| KEGG modules |
M00051
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.388 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 86.2%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 9/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 74.5% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) essential
| DeJesus 2017 call | ES · essential |
|---|---|
| What the call means | essential: insertions absent across the whole ORF |
| TA sites (Himar1) | 13 in the ORF — 12 in the essential state, 0 growth-defect, 1 non-essential, 0 growth-advantage. Saturation 0.077, mean read count 57. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain
This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.
| Hypomorph strain | pyrE-FLAG-tetOn-1 (TetON promoter 1) |
|---|---|
| Baseline knockdown fitness | 1.599 median doublings (across 6 screen pool(s)) — fewer doublings = stronger growth defect on knockdown |
| Used in target deconvolution | no (Excluded - slow growth (less than 1 doubling in a screening wave)) |
Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.
Proteomics (mass spectrometry) detected
| MS detection | detected in 11 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 86.7 ppm · rank 1403/3519 (60.2th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 179 aa |
|---|---|
| Molecular weight | 18.9 kDa |
| Theoretical pI | 5.86 |
| GRAVY | 0.068 (hydrophobic) |
| Aliphatic index | 103.5 |
| Aromaticity | 0.034 |
| Instability index | 24.2 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Pribosyltran | PF00156.34 | 1.6e-08 | 107–157 | Phosphoribosyl transferase domain |
Experimental structures (Protein Data Bank) 3 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
5hkl |
X-ray diffraction | 1.899 Å | 100% |
5hkf |
X-ray diffraction | 2.25 Å | 100% |
5hki |
X-ray diffraction | 2.4 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (3 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 93.3
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
5hki-assembly2_D |
1.00 | 0.96 | 2.2e-36 sig | 5hki-assembly2_D Crystal structure of Mycobacterium tuberculosis H37Rv orotate phosphoribosyltransferase in complex with Fe(III) dicitrate |
5hkl-assembly1_A |
1.00 | 0.99 | 3.2e-34 sig | 5hkl-assembly1_A Crystal structure of Mycobacterium tuberculosis H37Rv orotate phosphoribosyltransferase in complex with inorganic phosphate |
5hki-assembly2_C |
1.00 | 0.98 | 3.4e-34 sig | 5hki-assembly2_C Crystal structure of Mycobacterium tuberculosis H37Rv orotate phosphoribosyltransferase in complex with Fe(III) dicitrate |
5hkl-assembly1_B |
1.00 | 0.93 | 4.4e-32 sig | 5hkl-assembly1_B Crystal structure of Mycobacterium tuberculosis H37Rv orotate phosphoribosyltransferase in complex with inorganic phosphate |
5hkf-assembly1_A |
1.00 | 0.99 | 4.4e-31 sig | 5hkf-assembly1_A Crystal structure of Mycobacterium tuberculosis H37Rv orotate phosphoribosyltransferase in complex with 5-phospho-alpha-D-ribosyl 1-diphosphate (PRPP) |
Foldseek search of the AlphaFold DB model (mean pLDDT 93.3, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | Rv0381c (- strand, 17 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv0383c (- strand, 80 bp gap) |
| Predicted operon |
Rv0381c · pyrE
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: Rv0380c (RNA methyltransferase), high confidence from genomic context alone (score 776 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1385 pyrF exp |
orotidine 5'-phosphate decarboxylase | 993 | 979 | coexpression:734 database:900 textmining:697 |
Rv2139 pyrD exp |
dihydroorotate dehydrogenase | 990 | 979 | coexpression:734 database:900 textmining:590 |
Rv0381c hyp |
hypothetical protein | 867 | 867 ctx | neighborhood:863 |
Rv1381 pyrC |
dihydroorotase | 912 | 827 | coexpression:731 textmining:518 |
Rv1384 carB |
carbamoyl-phosphate synthase large subunit | 841 | 818 | coexpression:732 |
Rv1017c prsA exp |
ribose-phosphate pyrophosphokinase | 885 | 816 | database:800 textmining:403 |
Rv1383 carA |
carbamoyl-phosphate synthase small subunit | 826 | 800 | coexpression:730 |
Rv0383c ttfA hyp |
hypothetical protein | 785 | 786 ctx | neighborhood:786 |
Rv0380c |
RNA methyltransferase | 775 | 776 ctx | neighborhood:765 |
Rv0385 |
monooxygenase | 790 | 770 | coexpression:671 |
Rv1380 pyrB |
aspartate carbamoyltransferase | 895 | 761 | coexpression:730 textmining:580 |
Rv1937 |
oxygenase | 800 | 730 | coexpression:715 |
Rv1379 pyrR |
bifunctional pyrimidine operon regulatory protein/uracil phosphoribosyltransferase | 819 | 713 | coexpression:697 |
Rv0384c clpB |
chaperone protein ClpB | 762 | 702 ctx | neighborhood:699 |
Rv1382 hyp |
hypothetical protein | 707 | 681 | coexpression:670 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): orotate phosphoribosyltransferase
- Pfam (hmmscan --cut_ga): Pribosyltran PF00156.34 (E=2e-08)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177723.1)
- Domains: Pfam-A via hmmscan --cut_ga — Pribosyltran (PF00156.34)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0461 - Curated reference: UniProt P9WHK9 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 93.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
54 functional partner(s); context anchor
Rv0380c - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv0382c|pyrE MAGPDRAELAELVRRLSVVHGRVTLSSGREADYYVDLRRATLHHRASALIGRLMRELTADWDYSVVGGLTLGADPVATAIMHAPGRPIDAFVVRKSAKAHGMQRLIEGSEVTGQRVLVVEDTSTTGNSALTAVHAVQDVGGEVVGVATVVDRATGAAEAIEAEGLRYRSVLGLADLGLD
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for pyrE? Email the maintainer — the message is pre-filled with this gene's details.