Rv0385 Resolved · high auto-curated
H37Rv Rv0385 · MTBC0 mtbc0_000405 ·
390 aa · 465497–466669 (+) ·
RefSeq NP_214899.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | monooxygenase |
|---|---|
| MTBC0 PGAP re-annotation | FAD-binding oxidoreductase |
| Revised (this work) | FAD-binding oxidoreductase. Pfam: Globin (PF00042.29), FAD_binding_6 (PF00970.31), NAD_binding_1 (PF00175.27). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
Q7ARS9
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | nitric oxide dioxygenase |
| EC (curated) |
EC 1.14.12.17
|
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
C Energy production and conversion
|
|---|---|
| eggNOG description | Belongs to the globin family |
| Orthologous group | COG0543 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.176 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Globin | PF00042.29 | 1.7e-09 | 26–125 | Globin |
FAD_binding_6 | PF00970.31 | 2.2e-19 | 151–243 | Oxidoreductase FAD-binding domain |
NAD_binding_1 | PF00175.27 | 7.3e-05 | 253–370 | Oxidoreductase NAD-binding domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: clpB (chaperone protein ClpB), medium confidence from genomic context alone (score 621 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2139 pyrD |
dihydroorotate dehydrogenase | 958 | 953 | coexpression:731 experimental:814 |
Rv0383c ttfA hyp |
hypothetical protein | 859 | 846 ctx | neighborhood:427 coexpression:669 |
Rv1385 pyrF |
orotidine 5'-phosphate decarboxylase | 792 | 779 | coexpression:733 |
Rv1384 carB |
carbamoyl-phosphate synthase large subunit | 798 | 771 | coexpression:731 |
Rv0382c pyrE |
orotate phosphoribosyltransferase | 790 | 770 | coexpression:671 |
Rv1371 |
membrane protein | 835 | 751 | database:661 |
Rv1380 pyrB |
aspartate carbamoyltransferase | 775 | 746 | coexpression:731 |
Rv1383 carA |
carbamoyl-phosphate synthase small subunit | 777 | 745 | coexpression:730 |
Rv1883c hyp |
hypothetical protein | 760 | 732 | coexpression:713 |
Rv2778c hyp |
hypothetical protein | 760 | 732 | coexpression:713 |
Rv1381 pyrC |
dihydroorotase | 757 | 725 | coexpression:709 |
Rv1382 hyp |
hypothetical protein | 719 | 690 | coexpression:676 |
Rv1379 pyrR |
bifunctional pyrimidine operon regulatory protein/uracil phosphoribosyltransferase | 685 | 665 | coexpression:646 |
Rv0384c clpB |
chaperone protein ClpB | 620 | 621 ctx | neighborhood:615 |
Rv0816c thiX |
thioredoxin ThiX | 586 | 568 | database:506 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: monooxygenase
- MTBC0 PGAP product: FAD-binding oxidoreductase
- Pfam (hmmscan --cut_ga): Globin PF00042.29 (E=2e-09), FAD_binding_6 PF00970.31 (E=2e-19), NAD_binding_1 PF00175.27 (E=7e-05)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214899.1)
- Domains: Pfam-A via hmmscan --cut_ga — Globin (PF00042.29), FAD_binding_6 (PF00970.31), NAD_binding_1 (PF00175.27)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0543 - Curated reference: UniProt Q7ARS9 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
65 functional partner(s); context anchor
clpB - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000405|Rv0385| MGLEDRDALRVLQNAFKLDDPELVRRFYAHWFALDASVRDLFPPDMGAQRAAFGQALHWVYGELVAQRAEEPVAFLAQLGRDHRKYGVLPTQYDTLRRALYTTLRDYLGHPSRGAWTDAVDEAAGQSLNLIIGVMSGAADADDAPAWWDGTVVEHIRVSRDLAVARLQLDRPLHYYPGQYVNVHVPQCPRRWRYLSPAIPADPNGRIEFHVRVVPGGLVSNAIVGETRPGDRWRLSGPHGAFRVDRDGGDVLMVAGSTGLAPLRALIIDLSRFAVNPRVHLFFGARYACELYDLPTLWQIAAHNPWLSVSPVSEYNGDPAWAADYPDVSAPRGLHVRQTGRLPDVVSRYGGWGDRQILICGGPAMVRATKAALIAKGAPPERIQHDPLSR