hbhA Resolved · medium auto-curated

H37Rv Rv0475 · MTBC0 mtbc0_000500 · 199 aa · 569162–569761 MTBC0 (+) · RefSeq NP_214989.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand Rv0463 (Rv0463) — dark: hypothetical protein Rv0464c (Rv0464c) — family_assigned: carboxymuconolactone decarboxylase family protein ramB (Rv0465c) — family_assigned: acetate metabolism transcriptional regulator RamB ramB Rv0466 (Rv0466) — requalified: acyl-[acyl-carrier-protein] thioesterase fadB2 (Rv0468) — requalified: 3-hydroxybutyryl-CoA dehydrogenase FadB2 fadB2 Rv0471c (Rv0471c) — requalified: 1%2C4-dihydroxy-2-naphthoate prenyltransferase Rv0472c (Rv0472c) — family_assigned: TetR/AcrR family transcriptional regulator Rv0473 (Rv0473) — dark: DUF445 domain-containing protein Rv0473 Rv0474 (Rv0474) — family_assigned: helix-turn-helix transcriptional regulator hbhA (Rv0475) — requalified: heparin-binding hemagglutinin HbhA Rv0477 (Rv0477) — dark: DUF2599 domain-containing protein deoC (Rv0478) — requalified: deoxyribose-phosphate aldolase Rv0479c (Rv0479c) — family_assigned: DUF2993 domain-containing protein Rv0479c Rv0480c (Rv0480c) — family_assigned: carbon-nitrogen hydrolase family protein Rv0480c Rv0481c (Rv0481c) — family_assigned: DUF2505 domain-containing protein murB (Rv0482) — requalified: UDP-N-acetylmuramate dehydrogenase murB lprQ (Rv0483) — requalified: L%2CD-transpeptidase LdtMt5 lprQ Rv0484c (Rv0484c) — family_assigned: SDR family oxidoreductase Rv0485 (Rv0485) — family_assigned: transcriptional regulator Rv0485 mshA (Rv0486) — requalified: D-inositol-3-phosphate glycosyltransferase mshA Rv0487 (Rv0487) — family_assigned: YbjN domain-containing protein 560 kb 564 kb 568 kb 572 kb 576 kb 580 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)heparin binding hemagglutinin HbhA
MTBC0 PGAP re-annotationheparin-binding hemagglutinin HbhA
Revised (this work)Heparin-binding hemagglutinin HbhA.
Functional category (TubercuList)cell wall and cell processes

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 186 publications

186 TB publications mention this gene. 186 publication(s) discuss this gene (165 in a M. tuberculosis context, 30 in other mycobacteria — M. smegmatis (27), M. leprae (3), M. marinum (1)).

Most recent 5 of 186.
PublicationDate
mRNA-based tuberculosis vaccines BNT164a1 and BNT164b1 are immunogenic, well tolerated and efficacious in rodent models. doi:10.1038/s41590-026-02545-z 2026
Mycobacterial HBHA drives mitochondrial damage-mediated apoptosis via inhibiting mitophagy in macrophages. doi:10.1016/j.molimm.2026.06.005 2026
In silico design of a citrullinated protein-based multi-epitope vaccine for rheumatoid arthritis using immunoinformatics. doi:10.1016/j.intimp.2026.116615 2026
Mycobacterium cajalii sp. nov., a novel scotochromogenic rapid-growing nontuberculous mycobacterial species closely related to Mycobacterium servetii. doi:10.1007/s10482-026-02301-1 2026
From T-cell sensitization to molecular-intelligent stratification: a roadmap for precision diagnosis of latent tuberculosis infection. doi:10.1128/cmr.00258-25 2026

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Intrinsic disorder (sequence + structure) partially disordered

Predicted disorder26% of residues (metapredict) · mean AlphaFold pLDDT 69.2
Disordered regions1 IDR(s), longest 44 aa [155-199]

carries a substantial disordered region (44/199 residues); disorder is a property, not a function

A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).

CRISPRi vulnerability

Vulnerability index 0.13 (95% CI -1.07 to 1.64). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionRequired for extrapulmonary dissemination. Mediates adherence to epithelial cells by binding to sulfated glycoconjugates present at the surface of these cells; binds heparin, dextran sulfate, fucoidan and chondroitin sulfate. Promotes hemagglutination of erythrocytes of certain host species. Induces mycobacterial aggregation.

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb0485 · 100.0% identity
M. leprae ML2454c · 47.0% identity
M. marinum MMAR_0800 · 57.1% identity
M. smegmatis MSMEG_0919 · 45.2% identity
M. orygis RJtmp_000499 · 100.0% identity
M. abscessus MAB_4083c · 44.8% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WIP9 SwissProt · reviewed · Evidence at protein level
UniProt nameHeparin-binding hemagglutinin
Curated functionRequired for extrapulmonary dissemination. Mediates adherence to epithelial cells by binding to sulfated glycoconjugates present at the surface of these cells; binds heparin, dextran sulfate, fucoidan and chondroitin sulfate. Promotes hemagglutination of erythrocytes of certain host species. Induces mycobacterial aggregation.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namehbhA
eggNOG descriptionRequired for extrapulmonary dissemination. mediates adherence to epithelial cells by binding to sulfated glycoconjugates present at the surface of these cells
Orthologous group2EBKM
KEGG orthology K16645
Gene Ontology (55) GO:0003674, GO:0005488, GO:0005515, GO:0005539, GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0007155 +43 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Corynebacteriales

M. canettii dN/dS (deep-divergence selection) 0.0 (low power) · 1 consensus substitution(s)
low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 86.0% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 4/13 non-Mycobacterium reference genomes (down to Corynebacteriales) · mean identity 56.8%
detected across the order Corynebacteriales (Corynebacterium/Nocardia/Rhodococcus/…) but not in more distant Actinomycetia — a Corynebacteriales-level gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callGA · growth-advantage
What the call meansgrowth-advantage: insertions enriched
TA sites (Himar1) 10 in the ORF — 0 in the essential state, 0 growth-defect, 0 non-essential, 10 growth-advantage. Saturation 1.000, mean read count 130.2. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype

Conditionlog2FCqEffect
fitness in mouse infection (in vivo) +2.130.0 disruption advantageous
fitness in mouse infection (in vivo) +1.830.0052 disruption advantageous
fitness in mouse infection (in vivo) +1.340.034 disruption advantageous
fitness in mouse infection (in vivo) +1.310.035 disruption advantageous

Conditional fitness of transposon-disruption mutants across 4 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.

Proteomics (mass spectrometry) detected

MS detectiondetected in 16 of 16 independent MS datasets
Integrated abundance3378.0 ppm · rank 29/3519 (99.2th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length199 aa
Molecular weight21.5 kDa
Theoretical pI9.17
GRAVY-0.593 (hydrophilic)
Aliphatic index84.7
Aromaticity0.025
Instability index46.7 (unstable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Genomic context (neighbours & predicted operon)

Upstream (5' on genome)Rv0474 (+ strand, 353 bp gap)
Downstream (3' on genome)Rv0476 (+ strand, 111 bp gap)

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (4 TF) Rv0023 (activates) · Rv0081 (activates) · Rv0474 (represses) · tcrA (represses)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: Rv0476 (transmembrane protein), high confidence from genomic context alone (score 827 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0477 hyp hypothetical protein 835 829 ctx neighborhood:766
Rv0476 transmembrane protein 827 827 ctx neighborhood:766
Rv0383c ttfA hyp hypothetical protein 772 772 ctx cooccurence:772
Rv3850 hyp hypothetical protein 770 770 ctx cooccurence:768
Rv0996 transmembrane protein 770 770 ctx cooccurence:767
Rv1109c hyp hypothetical protein 768 769 ctx cooccurence:768
Rv0556 transmembrane protein 768 768 ctx cooccurence:768
Rv0817c lmeA hyp hypothetical protein 764 764 ctx cooccurence:764
Rv2732c transmembrane protein 764 764 ctx cooccurence:762
Rv3205c hyp hypothetical protein 760 760 ctx cooccurence:758
Rv1222 rseA anti-sigma E factor RseA 753 754 ctx cooccurence:750
Rv2446c integral membrane protein 751 752 ctx cooccurence:751
Rv3212 hyp hypothetical protein 750 751 ctx cooccurence:747
Rv0358 hyp hypothetical protein 750 751 ctx cooccurence:750
Rv2360c hyp hypothetical protein 750 750 ctx cooccurence:750

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: heparin binding hemagglutinin HbhA
  • MTBC0 PGAP product: heparin-binding hemagglutinin HbhA
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214989.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2EBKM
  • Curated reference: UniProt P9WIP9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 165 functional partner(s); context anchor Rv0476
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000500|Rv0475|hbhA
MAENSNIDDIKAPLLAALGAADLALATVNELITNLRERAEETRTDTRSRVEESRARLTKLQEDLPEQLTELREKFTAEELRKAAEGYLEAATSRYNELVERGEAALERLRSQQSFEEVSARAEGYVDQAVELTQEALGTVASQTRAVGERAAKLVGIELPKKAAPAKKAAPAKKAAPAKKAAAKKAPAKKAAAKKVTQK