Rv2083 Still unknown · low auto-curated

H37Rv Rv2083 · MTBC0 mtbc0_002219 · 314 aa · 2369484–2370428 (+) · RefSeq NP_216599.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Conserved hypothetical protein; no recognised domain. Function unknown.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WLK3 SwissProt · reviewed · Predicted
UniProt nameUncharacterized protein Rv2083

UniProt still lists this protein as Uncharacterized protein Rv2083; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2BK8T
Gene Ontology (6) GO:0005575, GO:0005623, GO:0005886, GO:0016020, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.61 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 5 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.36% of strains (518) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2081c (transmembrane protein), medium confidence from genomic context alone (score 496 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2084 hyp hypothetical protein 853 853 ctx neighborhood:801
Rv2082 hyp hypothetical protein 827 827 ctx neighborhood:785
Rv2085 hyp hypothetical protein 571 572 ctx neighborhood:552
Rv2086 hyp hypothetical protein 556 556 ctx neighborhood:552
Rv1617 pykA pyruvate kinase 513 513 coexpression:513
Rv2081c transmembrane protein 496 496 ctx neighborhood:491
Rv2087 Rv2087, (MTCY49.27), len: 76 aa. Conserved hypothetical protein, similar to but shorter than transposases, but we can find no sequence error 413 412 ctx neighborhood:410
Rv0291 mycP3 membrane-anchored mycosin MycP 591 97 textmining:566
Rv0284 eccC3 ESX-3 secretion system protein EccC3 559 70 textmining:546
Rv0283 eccB3 ESX-3 secretion system protein EccB3 648 61 textmining:641
Rv0292 eccE3 ESX-3 secretion system protein EccE 556 54 textmining:550
Rv0290 eccD3 ESX-3 secretion system protein EccD 633 51 textmining:630
Rv0282 eccA3 ESX-3 secretion system protein EccA 549 46 textmining:547

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: hypothetical protein
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216599.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2BK8T
  • Curated reference: UniProt P9WLK3 (SwissProt, reviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 81.8, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 13 functional partner(s); context anchor Rv2081c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002219|Rv2083|
MTSIESHPEQYWAAAGRPGPVPLALGPVHPGGPTLIDLLMALFGLSTNADLGGTNADIEGDDTDRRAHAADAARKFSANEANAAEQMQGVGAQGMAQMASGIGGALSGALGGVMGPLTQLPQQAMQAGQGAMQPLMSAMQQAQGADGLAAVDGARLLDSIGGEPGLGSGAGGGDVGGGGAGGTTPTGYLGPPPVPTSSPPTTPAGAPTKSATMPPPGGASPASAHMGAAGMPMVPPGAMGARGEGSGQEKPVEKRVTAPAVPNGQPVKGRLTVPPSAPTTKPTDGKPVVRRRILLPEHKDFGRIAPDEKTDAGE