Rv2520c Still unknown · low auto-curated
H37Rv Rv2520c · MTBC0 mtbc0_002684 ·
75 aa · 2860278–2860505 (-) ·
RefSeq NP_217036.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | membrane protein |
|---|---|
| MTBC0 PGAP re-annotation | DUF3618 domain-containing protein |
| Revised (this work) | Conserved hypothetical protein; DUF domain(s) DUF3618. Function unknown. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
I6XEI0
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Possible conserved membrane protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Protein of unknown function (DUF3618) |
| Orthologous group | 2EUTX |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DUF3618 | PF12277.14 | 3.5e-18 | 3–48 | Protein of unknown function (DUF3618) |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: bcp (peroxiredoxin), high confidence from genomic context alone (score 784 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2521 bcp |
peroxiredoxin | 783 | 784 ctx | neighborhood:781 |
Rv3311 hyp |
hypothetical protein | 773 | 773 ctx | cooccurence:772 |
Rv1222 rseA |
anti-sigma E factor RseA | 770 | 770 ctx | cooccurence:770 |
Rv1209 hyp |
hypothetical protein | 768 | 768 ctx | cooccurence:768 |
Rv1109c hyp |
hypothetical protein | 767 | 767 ctx | cooccurence:766 |
Rv3004 cfp6 |
low molecular weight protein antigen 6 | 765 | 765 ctx | cooccurence:764 |
Rv3212 hyp |
hypothetical protein | 759 | 760 ctx | cooccurence:759 |
Rv2091c |
membrane protein | 756 | 757 ctx | cooccurence:756 |
Rv3013 hyp |
hypothetical protein | 752 | 752 ctx | cooccurence:737 |
Rv2468c hyp |
hypothetical protein | 749 | 750 ctx | cooccurence:745 |
Rv2170 |
GCN5-like N-acetyltransferase | 740 | 741 ctx | cooccurence:740 |
Rv1083 hyp |
hypothetical protein | 733 | 734 ctx | cooccurence:733 |
Rv2179c |
3'-5' exoribonuclease | 721 | 721 ctx | cooccurence:720 |
Rv2138 lppL |
lipoprotein LppL | 714 | 715 ctx | cooccurence:714 |
Rv2700 cei hyp |
hypothetical protein | 709 | 709 ctx | cooccurence:709 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: membrane protein
- MTBC0 PGAP product: DUF3618 domain-containing protein
- Pfam (hmmscan --cut_ga): DUF3618 PF12277.14 (E=3e-18)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217036.1)
- Domains: Pfam-A via hmmscan --cut_ga — DUF3618 (PF12277.14)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2EUTX - Curated reference: UniProt I6XEI0 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
82 functional partner(s); context anchor
bcp - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002684|Rv2520c| MVDRDPNTIKQEIDQTRDQLAATIDSLAERANPRRLADDAKTRVIAFLRKPIVTVSLVGIGSVVVVVVIHKIRNR