Rv2520c Still unknown · low auto-curated

H37Rv Rv2520c · MTBC0 mtbc0_002684 · 75 aa · 2860278–2860505 (-) · RefSeq NP_217036.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)membrane protein
MTBC0 PGAP re-annotationDUF3618 domain-containing protein
Revised (this work)Conserved hypothetical protein; DUF domain(s) DUF3618. Function unknown.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6XEI0 TrEMBL · unreviewed · Evidence at protein level
UniProt namePossible conserved membrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein of unknown function (DUF3618)
Orthologous group2EUTX

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF3618PF12277.14 3.5e-183–48 Protein of unknown function (DUF3618)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: bcp (peroxiredoxin), high confidence from genomic context alone (score 784 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2521 bcp peroxiredoxin 783 784 ctx neighborhood:781
Rv3311 hyp hypothetical protein 773 773 ctx cooccurence:772
Rv1222 rseA anti-sigma E factor RseA 770 770 ctx cooccurence:770
Rv1209 hyp hypothetical protein 768 768 ctx cooccurence:768
Rv1109c hyp hypothetical protein 767 767 ctx cooccurence:766
Rv3004 cfp6 low molecular weight protein antigen 6 765 765 ctx cooccurence:764
Rv3212 hyp hypothetical protein 759 760 ctx cooccurence:759
Rv2091c membrane protein 756 757 ctx cooccurence:756
Rv3013 hyp hypothetical protein 752 752 ctx cooccurence:737
Rv2468c hyp hypothetical protein 749 750 ctx cooccurence:745
Rv2170 GCN5-like N-acetyltransferase 740 741 ctx cooccurence:740
Rv1083 hyp hypothetical protein 733 734 ctx cooccurence:733
Rv2179c 3'-5' exoribonuclease 721 721 ctx cooccurence:720
Rv2138 lppL lipoprotein LppL 714 715 ctx cooccurence:714
Rv2700 cei hyp hypothetical protein 709 709 ctx cooccurence:709

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: membrane protein
  • MTBC0 PGAP product: DUF3618 domain-containing protein
  • Pfam (hmmscan --cut_ga): DUF3618 PF12277.14 (E=3e-18)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217036.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF3618 (PF12277.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2EUTX
  • Curated reference: UniProt I6XEI0 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 82 functional partner(s); context anchor bcp
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002684|Rv2520c|
MVDRDPNTIKQEIDQTRDQLAATIDSLAERANPRRLADDAKTRVIAFLRKPIVTVSLVGIGSVVVVVVIHKIRNR