tatA Family assigned · medium auto-curated

H37Rv Rv2094c · MTBC0 mtbc0_002228 · 83 aa · 2381670–2381921 (-) · RefSeq NP_216610.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)Sec-independent protein translocase membrane-bound protein TatA
MTBC0 PGAP re-annotationSec-independent protein translocase subunit TatA
Revised (this work)Sec-independent protein translocase subunit TatA. Pfam: TatA_B_E (PF02416.22).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WGA1 SwissProt · reviewed · Evidence at protein level
UniProt nameSec-independent protein translocase protein TatA
Curated functionPart of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category U Intracellular trafficking, secretion and vesicular transport
Preferred nametatA
eggNOG descriptionPart of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system
Orthologous groupCOG1826
KEGG orthology K03116
KEGG pathways map03060, map03070
KEGG modules M00336
Gene Ontology (2) GO:0008150, GO:0040007

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
TatA_B_EPF02416.22 1.6e-174–49 mttA/Hcf106 family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: tatC (Sec-independent protein translocase transmembrane protein TatC), high confidence from genomic context alone (score 983 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2093c tatC Sec-independent protein translocase transmembrane protein TatC 994 983 ctx neighborhood:787 coexpression:706 experimental:629 textmining:668
Rv3396c guaA GMP synthase 935 933 coexpression:921
Rv2097c pafA proteasome accessory factor PafA 824 801 ctx neighborhood:796
Rv2096c pafB proteasome accessory factor B 809 799 ctx neighborhood:796
Rv2095c pafC proteasome accessory factor C 807 797 ctx neighborhood:796
Rv2092c helY ATP-dependent DNA helicase HelY 674 675 ctx neighborhood:673
Rv2091c membrane protein 533 533 ctx neighborhood:508
Rv1337 integral membrane protein 542 475 experimental:467
Rv2098c PE_PGRS36 PE-PGRS family protein PE_PGRS36; Rv2098c, (MTCY49.38c), len: 434 aa. PE_PGRS36,Member of the Mycobacterium tuberculosis PE family, PGRS sub 500 474 ctx neighborhood:471
Rv2099c PE21 Rv2099c, (MTCY49.39c), len: 58 aa. PE21, Member of the Mycobacterium tuberculosis PE family (see Brennan and Delogu, 2002); 5'-end of Rv2098 497 471 ctx neighborhood:471
Rv0110 integral membrane protein 575 469 experimental:467
Rv2146c transmembrane protein 467 468 ctx cooccurence:429
Rv2122c hisE phosphoribosyl-ATP pyrophosphatase 463 463
Rv0846c mmcO oxidase 556 433 experimental:415
Rv0799c hyp hypothetical protein 495 433 coexpression:401

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: Sec-independent protein translocase membrane-bound protein TatA
  • MTBC0 PGAP product: Sec-independent protein translocase subunit TatA
  • Pfam (hmmscan --cut_ga): TatA_B_E PF02416.22 (E=2e-17)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216610.1)
  • Domains: Pfam-A via hmmscan --cut_ga — TatA_B_E (PF02416.22)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1826
  • Curated reference: UniProt P9WGA1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 35 functional partner(s); context anchor tatC
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002228|Rv2094c|tatA
MGSLSPWHWAILAVVVIVLFGAKKLPDAARSLGKSLRIFKSEVRELQNENKAEASIETPTPVQSQRVDPSAASGQDSTEARPA