pepE Family assigned · medium auto-curated
H37Rv Rv2089c · MTBC0 mtbc0_002223 ·
375 aa ·
2374821–2375948 MTBC0
(-) ·
RefSeq NP_216605.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | dipeptidase PepE |
|---|---|
| MTBC0 PGAP re-annotation | Xaa-Pro peptidase family protein |
| Revised (this work) | Xaa-Pro peptidase family protein. Pfam: Creatinase_N (PF01321.25), Peptidase_M24 (PF00557.30). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 1 publication
1 TB publication mentions this gene. 1 publication(s) discuss this gene (8 in a M. tuberculosis context, 2 in other mycobacteria — ).
| Publication | Date |
|---|---|
| PE/PPE Proteome and ESX-5 Substrate Spectrum in Mycobacterium marinum. doi:10.3390/ijms25179550 | 2024 |
| Mycobacterial DNA-binding protein 1 is critical for BCG survival in stressful environments and simultaneously regulates gene expression. doi:10.1038/s41598-023-40941-9 | 2023 |
| Evolution of smooth tubercle Bacilli PE and PE_PGRS genes: evidence for a prominent role of recombination and imprint of positive selection. doi:10.1371/journal.pone.0064718 | 2013 |
| Bioinformatic identification of Mycobacterium tuberculosis proteins likely to target host cell mitochondria: virulence factors? doi:10.1186/2042-5783-2-9 | 2012 |
| Functional characterization of the Mycobacterium tuberculosis serine/threonine kinase PknJ. doi:10.1099/mic.0.038133-0 | 2010 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index 1.20 (95% CI -1.12 to 4.84). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Hydrolysis of peptide bonds |
|---|---|
| Mycobrowser EC |
3.4.13.-
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2116c
· 100.0% identity |
|---|---|
| M. marinum |
MMAR_3075
· 84.8% identity |
| M. smegmatis |
MSMEG_3881
· 78.1% identity |
| M. orygis |
RJtmp_002159
· 100.0% identity |
| M. abscessus |
MAB_2192
· 73.5% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WHS7
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Probable dipeptidase PepE |
| EC (curated) |
EC 3.4.13.-
|
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
E Amino acid transport and metabolism
|
|---|---|
| Preferred name | pepE |
| eggNOG description | Belongs to the peptidase M24B family |
| Orthologous group | COG0006 |
| EC number |
EC 3.4.13.9
|
| KEGG orthology |
K01271, K01274
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.272 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 8 synonymous, 5 missense, 1 nonsense, 1 frameshift |
| Disruption | 2 distinct premature-stop/frameshift site(s); most common in 0.54% of strains (777) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.121 (low power)
· 4 consensus substitution(s) low power (4 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 52/53 (98%) · mean identity 82.7%
· 4/4 closest MTBAP relatives conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 11/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 54.1% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 22 in the ORF — 0 in the essential state, 0 growth-defect, 22 non-essential, 0 growth-advantage. Saturation 0.909, mean read count 39.95. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 14 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 68.7 ppm · rank 1545/3519 (56.1th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 375 aa |
|---|---|
| Molecular weight | 39.4 kDa |
| Theoretical pI | 4.73 |
| GRAVY | 0.22 (hydrophobic) |
| Aliphatic index | 104.1 |
| Aromaticity | 0.059 |
| Instability index | 38.2 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Creatinase_N | PF01321.25 | 5.2e-06 | 14–146 | Creatinase/Prolidase N-terminal domain |
Peptidase_M24 | PF00557.30 | 5.7e-66 | 154–356 | Metallopeptidase family M24 |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 97.1
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
4ege-assembly1_A-2 |
1.00 | 1.00 | 5.9e-73 sig | 4ege-assembly1_A-2 Crystal Structure of Dipeptidase PepE from Mycobacterium ulcerans |
4rgz-assembly2_e |
1.00 | 0.90 | 8.8e-41 sig | 4rgz-assembly2_e Crystal structure of recombinant prolidase from Thermococcus sibiricus at P21221 spacegroup |
1wn1-assembly1_A |
1.00 | 0.93 | 8.4e-39 sig | 1wn1-assembly1_A Crystal Structure of Dipeptiase from Pyrococcus Horikoshii OT3 |
6xmr-assembly1_B |
1.00 | 0.82 | 6.6e-39 sig | 6xmr-assembly1_B X-ray crystallographic structure model of Lactococcus lactis prolidase mutant H38S |
3q6d-assembly2_B |
1.00 | 0.89 | 3.0e-36 sig | 3q6d-assembly2_B Xaa-Pro dipeptidase from Bacillus anthracis. |
Foldseek search of the AlphaFold DB model (mean pLDDT 97.1, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | pknJ (+ strand, 16 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv2090 (+ strand, 48 bp gap) |
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: Rv2090 (5'-3' exonuclease), high confidence from genomic context alone (score 799 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2090 |
5'-3' exonuclease | 807 | 799 ctx | neighborhood:788 |
Rv2438c nadE exp |
glutamine-dependent NAD(+) synthetase | 616 | 616 | database:497 |
Rv0730 |
GCN5-like N-acetyltransferase | 627 | 605 ctx | neighborhood:544 |
Rv0480c exp |
amidohydrolase | 559 | 559 | database:497 |
Rv2996c serA1 |
D-3-phosphoglycerate dehydrogenase | 538 | 538 | |
Rv3336c trpS |
tryptophan--tRNA ligase | 519 | 498 | |
Rv0194 |
multidrug ABC transporter ATPase/permease | 506 | 489 | |
Rv2534c efp |
elongation factor P | 497 | 451 | |
Rv1972 |
Mce associated membrane protein | 466 | 445 | |
Rv2218 lipA exp |
lipoyl synthase | 443 | 443 | database:424 |
Rv0728c serA2 |
D-3-phosphoglycerate dehydrogenase SerA | 442 | 442 | |
Rv1843c guaB1 |
inosine-5'-monophosphate dehydrogenase | 427 | 427 | |
Rv1362c |
membrane protein | 447 | 425 | |
Rv2390c hyp |
hypothetical protein | 442 | 419 | |
Rv1104 |
Rv1104, (MTV017.57), len: 229 aa. Possible para-nitrobenzyl esterase (fragment; possibly first part). Similar to the N-terminal domain of ma | 439 | 417 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: dipeptidase PepE
- MTBC0 PGAP product: Xaa-Pro peptidase family protein
- Pfam (hmmscan --cut_ga): Creatinase_N PF01321.25 (E=5e-06), Peptidase_M24 PF00557.30 (E=6e-66)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216605.1)
- Domains: Pfam-A via hmmscan --cut_ga — Creatinase_N (PF01321.25), Peptidase_M24 (PF00557.30)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0006 - Curated reference: UniProt P9WHS7 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 97.1)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
49 functional partner(s); context anchor
Rv2090 - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002223|Rv2089c|pepE MGSRRFDAEVYARRLALAAAATADAGLAGLVITPGYDLCYLIGSRAETFERLTALVLPAAGAPAVVLPRLELAALKQSAAAELGLRVCDWVDGDDPYGLVSAVLGGAPVATAVTDSMPALHMLPLADALGVLPVLATDVLRRLRMVKEETEIDALRKAGAAIDRVHARVPEFLVPGRTEADVAADIAEAIVAEGHSEVAFVIVGSGPHGADPHHGYSDRELREGDIVVVDIGGTYGPGYHSDSTRTYSIGEPDSDVAQSYSMLQRAQRAAFEAIRPGVTAEQVDAAARDVLAEAGLAEYFVHRTGHGIGLCVHEEPYIVAGNDLVLVPGMAFSIEPGIYFPGRWGARIEDIVIVTEDGAVSVNNCPHELIVVPVS
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for pepE? Email the maintainer — the message is pre-filled with this gene's details.