pepE Family assigned · medium auto-curated

H37Rv Rv2089c · MTBC0 mtbc0_002223 · 375 aa · 2374821–2375948 (-) · RefSeq NP_216605.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)dipeptidase PepE
MTBC0 PGAP re-annotationXaa-Pro peptidase family protein
Revised (this work)Xaa-Pro peptidase family protein. Pfam: Creatinase_N (PF01321.25), Peptidase_M24 (PF00557.30).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WHS7 SwissProt · reviewed · Evidence at protein level
UniProt nameProbable dipeptidase PepE
EC (curated) EC 3.4.13.-

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
Preferred namepepE
eggNOG descriptionBelongs to the peptidase M24B family
Orthologous groupCOG0006
EC number EC 3.4.13.9
KEGG orthology K01271, K01274

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.272 · purifying
Polymorphic sites (≥ 0.1% of strains) 8 synonymous, 5 missense, 1 nonsense, 1 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 0.54% of strains (777) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Creatinase_NPF01321.25 5.2e-0614–146 Creatinase/Prolidase N-terminal domain
Peptidase_M24PF00557.30 5.7e-66154–356 Metallopeptidase family M24

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2090 (5'-3' exonuclease), high confidence from genomic context alone (score 799 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2090 5'-3' exonuclease 807 799 ctx neighborhood:788
Rv2438c nadE glutamine-dependent NAD(+) synthetase 616 616 database:497
Rv0730 GCN5-like N-acetyltransferase 627 605 ctx neighborhood:544
Rv0480c amidohydrolase 559 559 database:497
Rv2996c serA1 D-3-phosphoglycerate dehydrogenase 538 538
Rv3336c trpS tryptophan--tRNA ligase 519 498
Rv0194 multidrug ABC transporter ATPase/permease 506 489
Rv2534c efp elongation factor P 497 451
Rv1972 Mce associated membrane protein 466 445
Rv2218 lipA lipoyl synthase 443 443 database:424
Rv0728c serA2 D-3-phosphoglycerate dehydrogenase SerA 442 442
Rv1843c guaB1 inosine-5'-monophosphate dehydrogenase 427 427
Rv1362c membrane protein 447 425
Rv2390c hyp hypothetical protein 442 419
Rv1104 Rv1104, (MTV017.57), len: 229 aa. Possible para-nitrobenzyl esterase (fragment; possibly first part). Similar to the N-terminal domain of ma 439 417

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: dipeptidase PepE
  • MTBC0 PGAP product: Xaa-Pro peptidase family protein
  • Pfam (hmmscan --cut_ga): Creatinase_N PF01321.25 (E=5e-06), Peptidase_M24 PF00557.30 (E=6e-66)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216605.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Creatinase_N (PF01321.25), Peptidase_M24 (PF00557.30)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0006
  • Curated reference: UniProt P9WHS7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 49 functional partner(s); context anchor Rv2090
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002223|Rv2089c|pepE
MGSRRFDAEVYARRLALAAAATADAGLAGLVITPGYDLCYLIGSRAETFERLTALVLPAAGAPAVVLPRLELAALKQSAAAELGLRVCDWVDGDDPYGLVSAVLGGAPVATAVTDSMPALHMLPLADALGVLPVLATDVLRRLRMVKEETEIDALRKAGAAIDRVHARVPEFLVPGRTEADVAADIAEAIVAEGHSEVAFVIVGSGPHGADPHHGYSDRELREGDIVVVDIGGTYGPGYHSDSTRTYSIGEPDSDVAQSYSMLQRAQRAAFEAIRPGVTAEQVDAAARDVLAEAGLAEYFVHRTGHGIGLCVHEEPYIVAGNDLVLVPGMAFSIEPGIYFPGRWGARIEDIVIVTEDGAVSVNNCPHELIVVPVS