Rv0481c Family assigned · low
H37Rv Rv0481c · MTBC0 mtbc0_000506 ·
174 aa ·
573353–573877 MTBC0
(-) ·
RefSeq NP_214995.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | DUF2505 domain-containing protein |
| Revised (this work) | DUF2505; ESMFold matches a START-like / Ups1 lipid-transfer fold (PDB 5JQM); putative lipid-binding protein. |
| Functional category (TubercuList) | conserved hypotheticals |
In the literature (TB corpus sweep) never studied
No publication in PubMed mentions this gene in its title or abstract — not under its H37Rv locus tag, nor under any of its ortholog identifiers (M. bovis, M. marinum, M. smegmatis, M. leprae, M. abscessus). The atlas annotation rests on sequence/structure evidence, not on a primary study of this gene.
A verified absence of literature is itself information: it flags an annotation with no primary study behind it. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole), MULTI-ALIAS sweep: H37Rv locus tag AND every ortholog identifier (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), each hit VERIFIED against the abstract text (word-boundary regex). phase73/phase75, 2026-07-13.
Conditional expression context (iModulons)
Member of 1 independently-modulated gene set(s):
IdeR (ideR).
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index -1.89 (95% CI -8.63 to 5.27). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb0491c
· 100.0% identity |
|---|---|
| M. marinum |
MMAR_0807
· 79.8% identity |
| M. smegmatis |
MSMEG_0927
· 53.2% identity |
| M. orygis |
RJtmp_000505
· 100.0% identity |
| M. abscessus |
MAB_4067
· 47.1% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WKV5
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Uncharacterized protein Rv0481c |
UniProt still lists this protein as Uncharacterized protein Rv0481c; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Protein of unknown function (DUF2505) |
| Orthologous group | 2ED3C |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Corynebacteriales
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 68.6%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 4/13 non-Mycobacterium reference genomes (down to Corynebacteriales) · mean identity 36.8% detected across the order Corynebacteriales (Corynebacterium/Nocardia/Rhodococcus/…) but not in more distant Actinomycetia — a Corynebacteriales-level gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 12 in the ORF — 0 in the essential state, 0 growth-defect, 6 non-essential, 6 growth-advantage. Saturation 1.000, mean read count 185.583333333. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 9 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 24.1 ppm · rank 2212/3519 (37.2th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 174 aa |
|---|---|
| Molecular weight | 19.1 kDa |
| Theoretical pI | 4.94 |
| GRAVY | -0.076 (hydrophilic) |
| Aliphatic index | 96.8 |
| Aromaticity | 0.063 |
| Instability index | 45.2 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DUF2505 | PF10698.16 | 1.7e-45 | 7–170 | Protein of unknown function (DUF2505) |
Structural neighbours (Foldseek on the ESMFold model, exploratory)
ESMFold model confidence: mean pLDDT 95.8 (very high). A confident model makes the fold comparison meaningful.
Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.
| Target | Prob | TM | E-value | Description |
|---|---|---|---|---|
5jqm-assembly1_B |
1.00 | 0.66 | 2.4e-07 sig | 5jqm-assembly1_B Crystal Structure of Phosphatidic acid Transporter Ups1/Mdm35 Void of Bound Phospholipid from Saccharomyces Cerevisiae at 1.5 Angstroms Resolution |
8ag0-assembly1_A |
1.00 | 0.63 | 1.0e-07 sig | 8ag0-assembly1_A Crystal structure of mutant PRELID3a-TRIAP1 complex - R53E |
2d4r-assembly1_A |
1.00 | 0.69 | 3.7e-07 sig | 2d4r-assembly1_A Crystal structure of TTHA0849 from Thermus thermophilus HB8 |
6cay-assembly1_A |
1.00 | 0.76 | 4.5e-06 sig | 6cay-assembly1_A Crystal structure of the first StART-like domain of Ysp2p/Lam2p in its apo and ergosterol-bound state. |
5jqm-assembly1_C |
1.00 | 0.64 | 8.3e-07 sig | 5jqm-assembly1_C Crystal Structure of Phosphatidic acid Transporter Ups1/Mdm35 Void of Bound Phospholipid from Saccharomyces Cerevisiae at 1.5 Angstroms Resolution |
5jqm-assembly1_A |
1.00 | 0.65 | 1.8e-06 sig | 5jqm-assembly1_A Crystal Structure of Phosphatidic acid Transporter Ups1/Mdm35 Void of Bound Phospholipid from Saccharomyces Cerevisiae at 1.5 Angstroms Resolution |
6byd-assembly1_A |
1.00 | 0.76 | 6.0e-05 sig | 6byd-assembly1_A Crystal structure of the second StART domain of yeast Lam4 |
6v8j-assembly4_D |
1.00 | 0.60 | 2.0e-06 sig | 6v8j-assembly4_D Crystal structure of Ara h 8.0201 |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 95.2
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
8ag0-assembly1_A |
1.00 | 0.68 | 2.0e-07 sig | 8ag0-assembly1_A Crystal structure of mutant PRELID3a-TRIAP1 complex - R53E |
6cay-assembly1_A |
1.00 | 0.75 | 4.0e-06 sig | 6cay-assembly1_A Crystal structure of the first StART-like domain of Ysp2p/Lam2p in its apo and ergosterol-bound state. |
2d4r-assembly1_A |
1.00 | 0.66 | 4.0e-07 sig | 2d4r-assembly1_A Crystal structure of TTHA0849 from Thermus thermophilus HB8 |
5jqm-assembly1_B |
1.00 | 0.65 | 1.9e-06 sig | 5jqm-assembly1_B Crystal Structure of Phosphatidic acid Transporter Ups1/Mdm35 Void of Bound Phospholipid from Saccharomyces Cerevisiae at 1.5 Angstroms Resolution |
5yqp-assembly2_B |
1.00 | 0.73 | 1.1e-05 sig | 5yqp-assembly2_B Crystal structure of the second StARkin domain of Lam4 |
Foldseek search of the AlphaFold DB model (mean pLDDT 95.2, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | Rv0480c (- strand, 181 bp gap) |
|---|---|
| Downstream (3' on genome) | murB (+ strand, 26 bp gap) |
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (2 TF) |
Rv1353c (represses) · Rv2034 (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: Rv0479c (membrane protein), high confidence from genomic context alone (score 877 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0479c |
membrane protein | 876 | 877 ctx | neighborhood:741 cooccurence:544 |
Rv0483 lprQ |
lipoprotein LprQ | 809 | 809 ctx | neighborhood:734 |
Rv0482 murB |
UDP-N-acetylenolpyruvoylglucosamine reductase | 792 | 792 ctx | neighborhood:790 |
Rv0996 |
transmembrane protein | 767 | 768 ctx | cooccurence:767 |
Rv0556 |
transmembrane protein | 764 | 765 ctx | cooccurence:764 |
Rv1109c hyp |
hypothetical protein | 764 | 765 ctx | cooccurence:764 |
Rv3212 hyp |
hypothetical protein | 760 | 761 ctx | cooccurence:754 |
Rv2091c |
membrane protein | 750 | 750 ctx | cooccurence:750 |
Rv2446c |
integral membrane protein | 747 | 747 ctx | cooccurence:747 |
Rv0480c |
amidohydrolase | 744 | 745 ctx | neighborhood:741 |
Rv0475 hbhA |
heparin binding hemagglutinin HbhA | 743 | 743 ctx | cooccurence:741 |
Rv3850 hyp |
hypothetical protein | 742 | 743 ctx | cooccurence:741 |
Rv3438 hyp |
hypothetical protein | 741 | 742 ctx | cooccurence:740 |
Rv0358 hyp |
hypothetical protein | 739 | 739 ctx | cooccurence:738 |
Rv0863 hyp |
hypothetical protein | 735 | 735 ctx | cooccurence:735 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- MTBC0 PGAP product: DUF2505 domain-containing protein
- Pfam: DUF2505 PF10698.16
- Foldseek best: 5jqm-assembly1_B Crystal Structure of Phosphatidic acid Transporter Ups1/Mdm35 V (prob 1.00, E=2e-07, TM=0.66)
- (structure-only promotion reviewed by hand, 2026-06-01)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214995.1)
- Domains: Pfam-A via hmmscan --cut_ga — DUF2505 (PF10698.16)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2ED3C - Curated reference: UniProt P9WKV5 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Model confidence: ESMFold per-residue pLDDT (mean 95.8, very high)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 95.2)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
95 functional partner(s); context anchor
Rv0479c - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000506|Rv0481c| MPRSFDMSADYEGSVEEVHRAFYEADYWKARLAETPVDVATLESIRVGGDSGDDGTIEVVTLQMVRSHNLPGLVTQLHRGDLSVRREETWGPVKEGIATASIAGSIVDAPVNLWGTAVLSPIPESGGSRMTLQVTIQVRIPFIGGKLERLIGTQLSQLVTIEQRFTTLWITNNV
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for Rv0481c? Email the maintainer — the message is pre-filled with this gene's details.