Rv2082 Still unknown · low auto-curated

H37Rv Rv2082 · MTBC0 mtbc0_002215 · 54 aa · 2366550–2366711 (+) · RefSeq NP_216598.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationDUF5631 domain-containing protein
Revised (this work)Conserved hypothetical protein; DUF domain(s) DUF5632, DUF5631. Function unknown.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt Q10690 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv2082

UniProt still lists this protein as Uncharacterized protein Rv2082; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2A1TI
Gene Ontology (33) GO:0002682, GO:0002684, GO:0008150, GO:0009605, GO:0009607, GO:0035821, GO:0043207, GO:0044003, GO:0044403, GO:0044419, GO:0048518, GO:0048583 +21 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 1.138 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 6 synonymous, 18 missense, 0 nonsense, 3 frameshift
Disruption 3 distinct premature-stop/frameshift site(s); most common in 4.14% of strains (6015) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF5632PF18646.7 1.0e-30511–593 Family of unknown function (DUF5632)
DUF5631PF18645.7 6.4e-40619–713 Family of unknown function (DUF5631)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: PE_PGRS16 (PE-PGRS family protein PE_PGRS16), high confidence from genomic context alone (score 833 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2086 hyp hypothetical protein 841 840 ctx neighborhood:552 cooccurence:655
Rv0977 PE_PGRS16 PE-PGRS family protein PE_PGRS16 838 833 ctx cooccurence:773
Rv3448 eccD4 ESX-4 secretion system protein EccD4 831 832 ctx cooccurence:715 coexpression:432
Rv2083 hyp hypothetical protein 827 827 ctx neighborhood:785
Rv2305 hyp hypothetical protein 818 818 ctx cooccurence:718
Rv2084 hyp hypothetical protein 807 807 ctx neighborhood:801
Rv2085 hyp hypothetical protein 795 796 ctx neighborhood:552 cooccurence:559
Rv0124 PE_PGRS2 PE-PGRS family protein PE_PGRS2 790 782 ctx cooccurence:774
Rv2490c PE_PGRS43 PE-PGRS family protein PE_PGRS43 790 782 ctx cooccurence:774
Rv1452c PE_PGRS28 PE-PGRS family protein PE_PGRS28 790 782 ctx cooccurence:774
Rv0872c PE_PGRS15 PE-PGRS family protein PE_PGRS15 790 782 ctx cooccurence:774
Rv1651c PE_PGRS30 PE-PGRS family protein PE_PGRS30 790 782 ctx cooccurence:774
Rv2853 PE_PGRS48 PE-PGRS family protein PE_PGRS48 789 781 ctx cooccurence:773
Rv1243c PE_PGRS23 PE-PGRS family protein PE_PGRS23 786 779 ctx cooccurence:770
Rv1917c PPE34 PPE family protein PPE34 777 777 ctx cooccurence:774

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: DUF5631 domain-containing protein
  • Pfam (hmmscan --cut_ga): DUF5632 PF18646.7 (E=1e-30), DUF5631 PF18645.7 (E=6e-40)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216598.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF5632 (PF18646.7), DUF5631 (PF18645.7)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2A1TI
  • Curated reference: UniProt Q10690 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 179 functional partner(s); context anchor PE_PGRS16
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002215|Rv2082|
MGDRRARIAPGIEELGPTLVETVRRRDALPRIAQAVVVAATRNYGVPDNETDLL