pafA Resolved · high auto-curated

H37Rv Rv2097c · MTBC0 mtbc0_002231 · 452 aa · 2383943–2385301 (-) · RefSeq NP_216613.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)proteasome accessory factor PafA
MTBC0 PGAP re-annotationPup--protein ligase
Revised (this work)Pup--protein ligase. Pfam: Pup_ligase (PF03136.21).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WNU7 SwissProt · reviewed · Evidence at protein level
UniProt namePup--protein ligase
EC (curated) EC 6.3.1.19
Curated functionCatalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine. PafA is required to confer resistance against the lethal effects of reactive nitrogen intermediates (RNI), antimicrobial molecules produced by activated macrophages and other cell types.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category F Nucleotide transport and metabolism
Preferred namepafA
eggNOG descriptionCatalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine
Orthologous groupCOG0638
EC number EC 6.3.1.19
KEGG orthology K13571
KEGG modules M00342
Gene Ontology (92) GO:0000166, GO:0000302, GO:0003674, GO:0003824, GO:0005488, GO:0005524, GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0006464, GO:0006508 +80 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.139 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 7 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Pup_ligasePF03136.21 4.2e-1714–423 Pup-ligase protein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: prcA (proteasome subunit alpha), high confidence from genomic context alone (score 934 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2109c prcA proteasome subunit alpha 985 934 ctx neighborhood:539 fusion:473 cooccurence:744 textmining:782
Rv2111c pup ubiquitin-like protein Pup 926 905 ctx neighborhood:504 cooccurence:769
Rv2096c pafB proteasome accessory factor B 985 893 ctx neighborhood:881 textmining:872
Rv2095c pafC proteasome accessory factor C 980 886 ctx neighborhood:881 textmining:839
Rv2110c prcB proteasome subunit beta 960 875 ctx neighborhood:539 cooccurence:734 textmining:696
Rv2115c mpa proteasome-associated ATPase 984 835 ctx cooccurence:774 textmining:908
Rv2094c tatA Sec-independent protein translocase membrane-bound protein TatA 824 801 ctx neighborhood:796
Rv3780 bpa hyp hypothetical protein 777 713 ctx cooccurence:709
Rv2112c dop pup deamidase/depupylase 718 666 database:500
Rv2092c helY ATP-dependent DNA helicase HelY 651 651 ctx neighborhood:561
Rv2093c tatC Sec-independent protein translocase transmembrane protein TatC 646 646 ctx neighborhood:641
Rv2098c PE_PGRS36 PE-PGRS family protein PE_PGRS36; Rv2098c, (MTCY49.38c), len: 434 aa. PE_PGRS36,Member of the Mycobacterium tuberculosis PE family, PGRS sub 624 624 ctx neighborhood:622
Rv2099c PE21 Rv2099c, (MTCY49.39c), len: 58 aa. PE21, Member of the Mycobacterium tuberculosis PE family (see Brennan and Delogu, 2002); 5'-end of Rv2098 622 622 ctx neighborhood:622
Rv2239c hyp hypothetical protein 609 610 ctx cooccurence:604
Rv3626c hyp hypothetical protein 508 508 ctx cooccurence:501

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: proteasome accessory factor PafA
  • MTBC0 PGAP product: Pup--protein ligase
  • Pfam (hmmscan --cut_ga): Pup_ligase PF03136.21 (E=4e-171)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216613.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Pup_ligase (PF03136.21)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0638
  • Curated reference: UniProt P9WNU7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 51 functional partner(s); context anchor prcA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002231|Rv2097c|pafA
MQRRIMGIETEFGVTCTFHGHRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGSHPEYATAECDSLVQLVTHDRAGEWVLEDLLVDAEQRLADEGIGGDIYLFKNNTDSAGNSYGCHENYLIVRAGEFSRISDVLLPFLVTRQLICGAGKVLQTPKAATYCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADAEKYRRLHVIVGDSNMSETTTMLKVGTAALVLEMIESGVAFRDFSLDNPIRAIREVSHDVTGRRPVRLAGGRQASALDIQREYYTRAVEHLQTREPNAQIEQVVDLWGRQLDAVESQDFAKVDTEIDWVIKRKLFQRYQDRYDMELSHPKIAQLDLAYHDIKRGRGIFDLLQRKGLAARVTTDEEIAEAVDQPPQTTRARLRGEFISAAQEAGRDFTVDWVHLKLNDQAQRTVLCKDPFRAVDERVKRLIASM