Rv2090 Resolved · high auto-curated

H37Rv Rv2090 · MTBC0 - · 393 aa · 2347373–2348554 H37Rv (+) · RefSeq NP_216606.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)5'-3' exonuclease
MTBC0 PGAP re-annotation
Revised (this work)5'-3' exonuclease. Pfam: 5_3_exonuc_N (PF02739.23), 5_3_exonuc (PF01367.26).
Functional category (TubercuList)information pathways

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

In the literature (TB corpus sweep) never studied

No publication mentions this gene in its title or abstract — not under its H37Rv locus tag, not under its gene name, and not under any ortholog identifier. Its annotation rests on sequence/structure evidence, with no primary study behind it.

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Intrinsic disorder (sequence + structure) partially disordered

Predicted disorder21% of residues (metapredict) · mean AlphaFold pLDDT 96.6
Disordered regions1 IDR(s), longest 75 aa [0-75]

carries a substantial disordered region (75/393 residues); disorder is a property, not a function

A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).

CRISPRi vulnerability

Vulnerability index 0.97 (95% CI -0.52 to 3.30). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionDNA metabolism
Mycobrowser EC 3.1.11.- · agrees with the atlas

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb2117 · 94.7% identity
M. marinum MMAR_3076 · 88.8% identity
M. smegmatis MSMEG_3883 · 75.1% identity
M. orygis RJtmp_002160 · 99.7% identity
M. abscessus MAB_2191c · 70.8% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WNU3 SwissProt · reviewed · Evidence at protein level
UniProt name5'-3' exonuclease
EC (curated) EC 3.1.11.-
Curated function5'-3' exonuclease acting preferentially on double-stranded DNA.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
Preferred namepolA_1
eggNOG description5'-3' exonuclease
Orthologous groupCOG0258
Gene Ontology (6) GO:0005575, GO:0005618, GO:0005623, GO:0030312, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.841 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 11 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

M. canettii dN/dS (deep-divergence selection) 0.575 (low power) · 5 consensus substitution(s)
low power (5 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 52/53 (98%) · mean identity 82.0% · 4/4 closest MTBAP relatives
conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 13/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 47.7%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 16 in the ORF — 0 in the essential state, 0 growth-defect, 16 non-essential, 0 growth-advantage. Saturation 0.938, mean read count 116.533333333. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 11 of 16 independent MS datasets
Integrated abundance81.2 ppm · rank 1448/3519 (58.9th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length393 aa
Molecular weight41.9 kDa
Theoretical pI5.58
GRAVY-0.204 (hydrophilic)
Aliphatic index89.2
Aromaticity0.043
Instability index44.8 (unstable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
5_3_exonuc_NPF02739.23 3.1e-4580–260 5'-3' exonuclease, N-terminal resolvase-like domain
5_3_exonucPF01367.26 2.0e-19269–353 5'-3' exonuclease, C-terminal SAM fold

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 96.6

PDB hitprobTM-scoreE-valueDescription
6c33-assembly1_A 1.00 0.99 3.7e-49 sig 6c33-assembly1_A Mycobacterium smegmatis DNA flap endonuclease
6c35-assembly1_A 1.00 0.99 7.5e-49 sig 6c35-assembly1_A Mycobacterium smegmatis flap endonuclease mutant D148N
6c36-assembly1_A 1.00 0.99 2.5e-48 sig 6c36-assembly1_A Mycobacterium smegmatis flap endonuclease mutant D208N
6c34-assembly1_A 1.00 0.99 8.5e-47 sig 6c34-assembly1_A Mycobacterium smegmatis DNA flap endonuclease mutant D125N
3zdb-assembly1_A-2 1.00 0.87 3.8e-12 sig 3zdb-assembly1_A-2 Structure of E. coli ExoIX in complex with the palindromic 5ov4 DNA oligonucleotide, di-magnesium and potassium

Foldseek search of the AlphaFold DB model (mean pLDDT 96.6, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon)

Upstream (5' on genome)pepE (- strand, 48 bp gap)
Downstream (3' on genome)Rv2091c (- strand, 3 bp gap)

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: recA (recombinase A), high confidence from genomic context alone (score 926 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2116 lppK exp lipoprotein LppK 948 944 experimental:772 database:630
Rv0002 dnaN exp DNA polymerase III subunit beta 948 944 experimental:772 database:630
Rv1277 hyp exp hypothetical protein 937 930 experimental:777 database:652
Rv2737c recA exp recombinase A 952 926 ctx cooccurence:537 experimental:455 database:585
Rv2529 hyp exp hypothetical protein 891 876 experimental:662 database:622
Rv3731 ligC exp DNA ligase C 858 849 experimental:429 database:569
Rv0938 ligD exp multifunctional non-homologous end joining DNA repair protein/ATP dependent DNA ligase LigD 877 828 experimental:429 database:569
Rv3062 ligB exp DNA ligase 834 823 experimental:429 database:569
Rv2101 helZ exp helicase HelZ 830 810 experimental:447 database:660
Rv1278 hyp exp hypothetical protein 829 807 experimental:432 database:652
Rv2089c pepE dipeptidase PepE 807 799 ctx neighborhood:788
Rv1329c dinG exp ATP-dependent helicase DinG 819 796 experimental:469 database:621
Rv1179c hyp exp hypothetical protein 766 753 experimental:430 database:580
Rv1947 hyp exp hypothetical protein 766 753 experimental:430 database:580
Rv1961 hyp exp hypothetical protein 766 752 experimental:430 database:580

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): 5'-3' exonuclease
  • Pfam (hmmscan --cut_ga): 5_3_exonuc_N PF02739.23 (E=3e-45), 5_3_exonuc PF01367.26 (E=2e-19)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216606.1)
  • Domains: Pfam-A via hmmscan --cut_ga — 5_3_exonuc_N (PF02739.23), 5_3_exonuc (PF01367.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0258
  • Curated reference: UniProt P9WNU3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 96.6)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 110 functional partner(s); context anchor recA
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2090|
MPAPDPMRGDPPHPAPPRLRSPLDPTSGDPLHPAPPRLRSPLDPTSGDPLHPAPPRLRSPLDPTSGDPLHPAPPRLRSPLVLLDGASMWFRSFFGVPSSITAPDGRPVNAVRGFIDSMAVVITQQRPNRLAVCLDLDWRPQFRVDLIPSYKAHRVAEPEPNGQPDVEEVPDELTPQVDMIMELLDAFGIAMAGAPGFEADDVLGTLATRERRDPVIVVSGDRDLLQVVADDPVPVRVLYLGRGLAKATLFGPAEVAERYGLPAHRAGAAYAELALLRGDPSDGLPGVPGVGEKTAATLLARHGSLDQIMAAADDRKTTMAKGLRTKLLAASAYIKAADRVVRVATDAPVTLSTPTDRFPLVAADPERTAELATRFGVESSIARLQKALDTLPG