Rv2090 Resolved · high auto-curated

H37Rv Rv2090 · MTBC0 - · 393 aa · 2347373–2348554 (+) · RefSeq NP_216606.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)5'-3' exonuclease
MTBC0 PGAP re-annotation
Revised (this work)5'-3' exonuclease. Pfam: 5_3_exonuc_N (PF02739.23), 5_3_exonuc (PF01367.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WNU3 SwissProt · reviewed · Evidence at protein level
UniProt name5'-3' exonuclease
EC (curated) EC 3.1.11.-
Curated function5'-3' exonuclease acting preferentially on double-stranded DNA.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
Preferred namepolA_1
eggNOG description5'-3' exonuclease
Orthologous groupCOG0258
Gene Ontology (6) GO:0005575, GO:0005618, GO:0005623, GO:0030312, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.841 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 11 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
5_3_exonuc_NPF02739.23 3.1e-4580–260 5'-3' exonuclease, N-terminal resolvase-like domain
5_3_exonucPF01367.26 2.0e-19269–353 5'-3' exonuclease, C-terminal SAM fold

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: recA (recombinase A), high confidence from genomic context alone (score 926 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2116 lppK lipoprotein LppK 948 944 experimental:772 database:630
Rv0002 dnaN DNA polymerase III subunit beta 948 944 experimental:772 database:630
Rv1277 hyp hypothetical protein 937 930 experimental:777 database:652
Rv2737c recA recombinase A 952 926 ctx cooccurence:537 experimental:455 database:585
Rv2529 hyp hypothetical protein 891 876 experimental:662 database:622
Rv3731 ligC DNA ligase C 858 849 experimental:429 database:569
Rv0938 ligD multifunctional non-homologous end joining DNA repair protein/ATP dependent DNA ligase LigD 877 828 experimental:429 database:569
Rv3062 ligB DNA ligase 834 823 experimental:429 database:569
Rv2101 helZ helicase HelZ 830 810 experimental:447 database:660
Rv1278 hyp hypothetical protein 829 807 experimental:432 database:652
Rv2089c pepE dipeptidase PepE 807 799 ctx neighborhood:788
Rv1329c dinG ATP-dependent helicase DinG 819 796 experimental:469 database:621
Rv1179c hyp hypothetical protein 766 753 experimental:430 database:580
Rv1947 hyp hypothetical protein 766 753 experimental:430 database:580
Rv1961 hyp hypothetical protein 766 752 experimental:430 database:580

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): 5'-3' exonuclease
  • Pfam (hmmscan --cut_ga): 5_3_exonuc_N PF02739.23 (E=3e-45), 5_3_exonuc PF01367.26 (E=2e-19)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216606.1)
  • Domains: Pfam-A via hmmscan --cut_ga — 5_3_exonuc_N (PF02739.23), 5_3_exonuc (PF01367.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0258
  • Curated reference: UniProt P9WNU3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 110 functional partner(s); context anchor recA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2090|
MPAPDPMRGDPPHPAPPRLRSPLDPTSGDPLHPAPPRLRSPLDPTSGDPLHPAPPRLRSPLDPTSGDPLHPAPPRLRSPLVLLDGASMWFRSFFGVPSSITAPDGRPVNAVRGFIDSMAVVITQQRPNRLAVCLDLDWRPQFRVDLIPSYKAHRVAEPEPNGQPDVEEVPDELTPQVDMIMELLDAFGIAMAGAPGFEADDVLGTLATRERRDPVIVVSGDRDLLQVVADDPVPVRVLYLGRGLAKATLFGPAEVAERYGLPAHRAGAAYAELALLRGDPSDGLPGVPGVGEKTAATLLARHGSLDQIMAAADDRKTTMAKGLRTKLLAASAYIKAADRVVRVATDAPVTLSTPTDRFPLVAADPERTAELATRFGVESSIARLQKALDTLPG