Rv2090 Resolved · high auto-curated
H37Rv Rv2090 · MTBC0 - ·
393 aa ·
2347373–2348554 H37Rv
(+) ·
RefSeq NP_216606.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | 5'-3' exonuclease |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | 5'-3' exonuclease. Pfam: 5_3_exonuc_N (PF02739.23), 5_3_exonuc (PF01367.26). |
| Functional category (TubercuList) | information pathways |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
In the literature (TB corpus sweep) never studied
No publication mentions this gene in its title or abstract — not under its H37Rv locus tag, not under its gene name, and not under any ortholog identifier. Its annotation rests on sequence/structure evidence, with no primary study behind it.
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Intrinsic disorder (sequence + structure) partially disordered
| Predicted disorder | 21% of residues (metapredict) · mean AlphaFold pLDDT 96.6 |
|---|---|
| Disordered regions | 1 IDR(s), longest 75 aa [0-75] |
carries a substantial disordered region (75/393 residues); disorder is a property, not a function
A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).
CRISPRi vulnerability
Vulnerability index 0.97 (95% CI -0.52 to 3.30). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | DNA metabolism |
|---|---|
| Mycobrowser EC |
3.1.11.-
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2117
· 94.7% identity |
|---|---|
| M. marinum |
MMAR_3076
· 88.8% identity |
| M. smegmatis |
MSMEG_3883
· 75.1% identity |
| M. orygis |
RJtmp_002160
· 99.7% identity |
| M. abscessus |
MAB_2191c
· 70.8% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WNU3
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | 5'-3' exonuclease |
| EC (curated) |
EC 3.1.11.-
|
| Curated function | 5'-3' exonuclease acting preferentially on double-stranded DNA. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
L Replication, recombination and repair
|
|---|---|
| Preferred name | polA_1 |
| eggNOG description | 5'-3' exonuclease |
| Orthologous group | COG0258 |
| Gene Ontology (6) |
GO:0005575, GO:0005618, GO:0005623, GO:0030312, GO:0044464, GO:0071944
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.841 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 5 synonymous, 11 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.575 (low power)
· 5 consensus substitution(s) low power (5 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 52/53 (98%) · mean identity 82.0%
· 4/4 closest MTBAP relatives conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 13/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 47.7% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 16 in the ORF — 0 in the essential state, 0 growth-defect, 16 non-essential, 0 growth-advantage. Saturation 0.938, mean read count 116.533333333. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 11 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 81.2 ppm · rank 1448/3519 (58.9th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 393 aa |
|---|---|
| Molecular weight | 41.9 kDa |
| Theoretical pI | 5.58 |
| GRAVY | -0.204 (hydrophilic) |
| Aliphatic index | 89.2 |
| Aromaticity | 0.043 |
| Instability index | 44.8 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
5_3_exonuc_N | PF02739.23 | 3.1e-45 | 80–260 | 5'-3' exonuclease, N-terminal resolvase-like domain |
5_3_exonuc | PF01367.26 | 2.0e-19 | 269–353 | 5'-3' exonuclease, C-terminal SAM fold |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 96.6
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
6c33-assembly1_A |
1.00 | 0.99 | 3.7e-49 sig | 6c33-assembly1_A Mycobacterium smegmatis DNA flap endonuclease |
6c35-assembly1_A |
1.00 | 0.99 | 7.5e-49 sig | 6c35-assembly1_A Mycobacterium smegmatis flap endonuclease mutant D148N |
6c36-assembly1_A |
1.00 | 0.99 | 2.5e-48 sig | 6c36-assembly1_A Mycobacterium smegmatis flap endonuclease mutant D208N |
6c34-assembly1_A |
1.00 | 0.99 | 8.5e-47 sig | 6c34-assembly1_A Mycobacterium smegmatis DNA flap endonuclease mutant D125N |
3zdb-assembly1_A-2 |
1.00 | 0.87 | 3.8e-12 sig | 3zdb-assembly1_A-2 Structure of E. coli ExoIX in complex with the palindromic 5ov4 DNA oligonucleotide, di-magnesium and potassium |
Foldseek search of the AlphaFold DB model (mean pLDDT 96.6, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | pepE (- strand, 48 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv2091c (- strand, 3 bp gap) |
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: recA (recombinase A), high confidence from genomic context alone (score 926 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2116 lppK exp |
lipoprotein LppK | 948 | 944 | experimental:772 database:630 |
Rv0002 dnaN exp |
DNA polymerase III subunit beta | 948 | 944 | experimental:772 database:630 |
Rv1277 hyp exp |
hypothetical protein | 937 | 930 | experimental:777 database:652 |
Rv2737c recA exp |
recombinase A | 952 | 926 ctx | cooccurence:537 experimental:455 database:585 |
Rv2529 hyp exp |
hypothetical protein | 891 | 876 | experimental:662 database:622 |
Rv3731 ligC exp |
DNA ligase C | 858 | 849 | experimental:429 database:569 |
Rv0938 ligD exp |
multifunctional non-homologous end joining DNA repair protein/ATP dependent DNA ligase LigD | 877 | 828 | experimental:429 database:569 |
Rv3062 ligB exp |
DNA ligase | 834 | 823 | experimental:429 database:569 |
Rv2101 helZ exp |
helicase HelZ | 830 | 810 | experimental:447 database:660 |
Rv1278 hyp exp |
hypothetical protein | 829 | 807 | experimental:432 database:652 |
Rv2089c pepE |
dipeptidase PepE | 807 | 799 ctx | neighborhood:788 |
Rv1329c dinG exp |
ATP-dependent helicase DinG | 819 | 796 | experimental:469 database:621 |
Rv1179c hyp exp |
hypothetical protein | 766 | 753 | experimental:430 database:580 |
Rv1947 hyp exp |
hypothetical protein | 766 | 753 | experimental:430 database:580 |
Rv1961 hyp exp |
hypothetical protein | 766 | 752 | experimental:430 database:580 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): 5'-3' exonuclease
- Pfam (hmmscan --cut_ga): 5_3_exonuc_N PF02739.23 (E=3e-45), 5_3_exonuc PF01367.26 (E=2e-19)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216606.1)
- Domains: Pfam-A via hmmscan --cut_ga — 5_3_exonuc_N (PF02739.23), 5_3_exonuc (PF01367.26)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0258 - Curated reference: UniProt P9WNU3 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 96.6)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
110 functional partner(s); context anchor
recA - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv2090| MPAPDPMRGDPPHPAPPRLRSPLDPTSGDPLHPAPPRLRSPLDPTSGDPLHPAPPRLRSPLDPTSGDPLHPAPPRLRSPLVLLDGASMWFRSFFGVPSSITAPDGRPVNAVRGFIDSMAVVITQQRPNRLAVCLDLDWRPQFRVDLIPSYKAHRVAEPEPNGQPDVEEVPDELTPQVDMIMELLDAFGIAMAGAPGFEADDVLGTLATRERRDPVIVVSGDRDLLQVVADDPVPVRVLYLGRGLAKATLFGPAEVAERYGLPAHRAGAAYAELALLRGDPSDGLPGVPGVGEKTAATLLARHGSLDQIMAAADDRKTTMAKGLRTKLLAASAYIKAADRVVRVATDAPVTLSTPTDRFPLVAADPERTAELATRFGVESSIARLQKALDTLPG
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for Rv2090? Email the maintainer — the message is pre-filled with this gene's details.