rpmB2 Resolved · high auto-curated
H37Rv Rv2058c · MTBC0 mtbc0_002191 ·
78 aa ·
2343438–2343674 MTBC0
(-) ·
RefSeq NP_216574.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | 50S ribosomal protein L28 |
|---|---|
| MTBC0 PGAP re-annotation | 50S ribosomal protein L28 |
| Revised (this work) | 50S ribosomal protein L28. Pfam: Ribosomal_L28 (PF00830.25). |
| Functional category (TubercuList) | information pathways |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 2 publications
2 TB publications mention this gene. 2 publication(s) discuss this gene (2 in a M. tuberculosis context, 2 in other mycobacteria — M. smegmatis (2)).
| Publication | Date |
|---|---|
| Boosting Immunogenicity of a Recombinant Mycobacterium smegmatis Strain via Zinc-Dependent Ribosomal Proteins. doi:10.3390/biomedicines12071571 | 2024 |
| Boosting bactericidal immunity of a recombinant Mycobacterium smegmatis strain via zinc-dependent ribosomal proteins. doi:10.1101/2023.12.11.571163 | 2023 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Intrinsic disorder (sequence + structure) highly disordered
| Predicted disorder | 41% of residues (metapredict) · mean AlphaFold pLDDT 94.6 |
|---|---|
| Disordered regions | 1 IDR(s), longest 33 aa [0-33] |
sequence-based disorder is high but AlphaFold folds it confidently (pLDDT>=70): treat the disorder call with caution (possible metapredict over-call)
A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).
Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene
| Neighbour | rpmG (Rv2057c, - strand) |
|---|---|
| Overlap | 1 bp, 0 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
Conditional expression context (iModulons)
Member of 2 independently-modulated gene set(s):
Zur (zur), Central Carbon Metabolism.
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in ribosome activity |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2084c
· 98.7% identity |
|---|---|
| M. marinum |
MMAR_0292
· 82.1% identity |
| M. smegmatis |
MSMEG_6068
· 80.8% identity |
| M. orygis |
RJtmp_002130
· 98.7% identity |
| M. abscessus |
MAB_0334c
· 85.7% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WHA9
SwissProt · reviewed
· Inferred from homology
|
|---|---|
| UniProt name | Large ribosomal subunit protein bL28B |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
J Translation, ribosomal structure and biogenesis
|
|---|---|
| Preferred name | rpmB |
| eggNOG description | Belongs to the bacterial ribosomal protein bL28 family |
| Orthologous group | COG0227 |
| KEGG orthology |
K02902
|
| KEGG pathways |
map03010
|
| KEGG modules |
M00178
|
| Gene Ontology (25) |
GO:0003674, GO:0003735, GO:0005198, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005840, GO:0015934, GO:0022625, GO:0022626 +13 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.367 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 45/53 (85%) · mean identity 74.5%
· 4/4 closest MTBAP relatives conserved across the genus (present in 45/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 11/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 66.2% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | GA · growth-advantage |
|---|---|
| What the call means | growth-advantage: insertions enriched |
| TA sites (Himar1) | 5 in the ORF — 0 in the essential state, 0 growth-defect, 0 non-essential, 5 growth-advantage. Saturation 1.000, mean read count 532. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Read with some caution: only 5 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 5 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 7 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 70.2 ppm · rank 1528/3519 (56.6th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 78 aa |
|---|---|
| Molecular weight | 9.1 kDa |
| Theoretical pI | 12.0 |
| GRAVY | -0.963 (hydrophilic) |
| Aliphatic index | 71.2 |
| Aromaticity | 0.051 |
| Instability index | 88.7 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Ribosomal_L28 | PF00830.25 | 8.2e-26 | 4–61 | Ribosomal L28 family |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 94.6
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
7uvx-assembly1_W |
1.00 | 0.96 | 7.1e-10 sig | 7uvx-assembly1_W A. baumannii 70S ribosome-Streptothricin-F complex |
6spf-assembly1_X |
1.00 | 0.96 | 9.8e-10 sig | 6spf-assembly1_X Pseudomonas aeruginosa 70s ribosome from an aminoglycoside resistant clinical isolate |
5afi-assembly1_X |
1.00 | 0.95 | 3.8e-09 sig | 5afi-assembly1_X 2.9A Structure of E. coli ribosome-EF-TU complex by cs-corrected cryo-EM |
7unw-assembly1_Z |
1.00 | 0.96 | 3.1e-09 sig | 7unw-assembly1_Z Pseudomonas aeruginosa 70S ribosome initiation complex bound to IF2-GDPCP (structure II-B) |
8fr8-assembly1_y |
1.00 | 0.92 | 9.2e-10 sig | 8fr8-assembly1_y Structure of Mycobacterium smegmatis Rsh bound to a 70S translation initiation complex |
Foldseek search of the AlphaFold DB model (mean pLDDT 94.6, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 4
| Upstream (5' on genome) | rpmG1 (- strand, -1 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv2059 (+ strand, 112 bp gap) |
| Predicted operon |
rpsR2 · rpsN2 · rpmG1 · rpmB2
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (5 TF) |
Rv0081 (activates) · Rv0767c (represses) · zur (represses) · Rv3488 (represses) · lsr2 (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: rpsN2 (30S ribosomal protein S14), high confidence from genomic context alone (score 999 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2056c rpsN2 exp |
30S ribosomal protein S14 | 999 | 999 ctx | neighborhood:882 coexpression:927 experimental:789 textmining:575 |
Rv2057c rpmG1 exp |
50S ribosomal protein L33 | 999 | 999 ctx | neighborhood:882 cooccurence:671 coexpression:906 experimental:789 textmining:787 |
Rv2055c rpsR2 exp |
30S ribosomal protein S18 | 999 | 995 ctx | neighborhood:882 coexpression:731 experimental:789 textmining:887 |
Rv0056 rplI exp |
50S ribosomal protein L9 | 988 | 987 | coexpression:708 experimental:956 |
Rv0979A rpmF exp |
50S ribosomal protein L32 | 974 | 966 | coexpression:731 experimental:829 |
Rv0053 rpsF exp |
30S ribosomal protein S6 | 963 | 959 | coexpression:728 experimental:829 |
Rv3443c rplM exp |
50S ribosomal protein L13 | 959 | 954 | coexpression:732 experimental:829 |
Rv2442c rplU exp |
50S ribosomal protein L21 | 959 | 954 | coexpression:732 experimental:829 |
Rv2904c rplS exp |
50S ribosomal protein L19 | 959 | 954 | coexpression:731 experimental:829 |
Rv2785c rpsO exp |
30S ribosomal protein S15 | 959 | 954 | coexpression:729 experimental:829 |
Rv2412 rpsT exp |
30S ribosomal protein S20 | 959 | 954 | coexpression:731 experimental:829 |
Rv2909c rpsP exp |
30S ribosomal protein S16 | 959 | 954 | coexpression:731 experimental:829 |
Rv0682 rpsL exp |
30S ribosomal protein S12 | 958 | 954 | coexpression:727 experimental:829 |
Rv1298 rpmE exp |
50S ribosomal protein L31 | 965 | 953 | coexpression:720 experimental:829 |
Rv2441c rpmA exp |
50S ribosomal protein L27 | 958 | 953 | coexpression:727 experimental:829 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: 50S ribosomal protein L28
- MTBC0 PGAP product: 50S ribosomal protein L28
- Pfam (hmmscan --cut_ga): Ribosomal_L28 PF00830.25 (E=8e-26)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216574.1)
- Domains: Pfam-A via hmmscan --cut_ga — Ribosomal_L28 (PF00830.25)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0227 - Curated reference: UniProt P9WHA9 (SwissProt, reviewed; Inferred from homology)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 94.6)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
203 functional partner(s); context anchor
rpsN2 - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002191|Rv2058c|rpmB2 MSAHCQVTGRKPGFGNTVSHSHRRSRRRWSPNIQQRTYYLPSEGRRIRLRVSTKGIKVIDRDGIEAVVARLRRQGQRI
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for rpmB2? Email the maintainer — the message is pre-filled with this gene's details.