cobH Resolved · high auto-curated
H37Rv Rv2065 · MTBC0 mtbc0_002199 ·
208 aa ·
2351165–2351791 MTBC0
(+) ·
RefSeq NP_216581.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | precorrin-8X methylmutase |
|---|---|
| MTBC0 PGAP re-annotation | precorrin-8X methylmutase |
| Revised (this work) | Precorrin-8X methylmutase. Pfam: CbiC (PF02570.21). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) never studied
No publication mentions this gene in its title or abstract — not under its H37Rv locus tag, not under its gene name, and not under any ortholog identifier. Its atlas annotation was built from sequence/structure evidence; UniProt nevertheless carries a reviewed entry with a named function for this protein, and experimental evidence that the protein exists (see below), so the absence of a locus-tag mention should not be read as the absence of any study.
Scope of the sweep: What was actually swept: the H37Rv locus tag and the ortholog locus tags (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), plus the gene name where one exists. NOT swept: protein and enzyme names, including family shorthands such as Ldt(Mt4) or VapC28, and their orthographic variants. An absent locus-tag mention is therefore evidence about the TAG, and only indirect evidence about the protein (P18.14).
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene
| Neighbour | cobIJ (Rv2066, + strand) |
|---|---|
| Overlap | 4 bp, 1 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index 0.62 (95% CI -0.23 to 1.85). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, supplementary Table S2 'mmc3.xlsx', bulk import via Europe PMC -- supersedes the per-gene pebble.rockefeller.edu scrape of phase46_crispri_vulnerability.py).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Required for cobalamin biosynthesis. |
|---|---|
| Mycobrowser EC |
5.4.1.2
· superseded EC numbering; the atlas uses the current class (5.4.99.60, 5.4.99.61)
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2091
· 99.5% identity |
|---|---|
| M. marinum |
MMAR_3045
· 87.0% identity |
| M. smegmatis |
MSMEG_3872
· 83.2% identity |
| M. orygis |
RJtmp_002137
· 99.5% identity |
| M. abscessus |
MAB_2199c
· 77.4% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WP87
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Precorrin-8X methylmutase |
| EC (curated) |
EC 5.4.99.61
|
| Curated function | Catalyzes the conversion of precorrin-8X to hydrogenobyrinate. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
H Coenzyme transport and metabolism
|
|---|---|
| Preferred name | cobH |
| eggNOG description | Precorrin-8X methylmutase |
| Orthologous group | COG2082 |
| EC number |
EC 5.4.99.60, EC 5.4.99.61
|
| KEGG orthology |
K06042
|
| KEGG pathways |
map00860, map01100
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.092 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 13 synonymous, 2 missense, 1 nonsense, 3 frameshift |
| Disruption | 4 distinct premature-stop/frameshift site(s); most common in 0.59% of strains (852) · convergent |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| M. canettii dN/dS (deep-divergence selection) |
0.067
· 16 consensus substitution(s) under purifying selection vs M. canettii (deep divergence; dN/dS=0.067) — a real, constrained gene predating the MTBC clonal expansion |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 47/53 (89%) · mean identity 85.0%
· 3/4 closest MTBAP relatives conserved across the genus (present in 47/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 8/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 60.4% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) |
8 in the ORF —
0 in the essential state,
0 growth-defect,
8 non-essential,
0 growth-advantage.
Saturation 1.000,
mean read count 91.375.
A region of the protein devoid of TA sites is invisible to this assay: nothing can be
inferred about it, in either direction.
All 8 sites lie in this ORF alone (no overlapping CDS shares any), so the call is attributable to this gene. |
| Caveat | Read with some caution: only 8 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 8 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 11 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 43.9 ppm · rank 1844/3519 (47.6th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 208 aa |
|---|---|
| Molecular weight | 21.6 kDa |
| Theoretical pI | 5.78 |
| GRAVY | 0.252 (hydrophobic) |
| Aliphatic index | 103.4 |
| Aromaticity | 0.038 |
| Instability index | 39.2 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
CbiC | PF02570.21 | 4.9e-68 | 10–204 | Precorrin-8X methylmutase |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 97.5
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
3e7d-assembly1_A |
1.00 | 0.97 | 3.5e-26 sig | 3e7d-assembly1_A Crystal Structure of Precorrin-8X Methyl Mutase CbiC/CobH from Brucella melitensis |
1f2v-assembly1_A |
1.00 | 0.98 | 1.2e-24 sig | 1f2v-assembly1_A CRYSTAL STRUCTURE ANALYSIS OF PRECORRIN-8X METHYLMUTASE OF AEROBIC VITAMIN B12 SYNTHESIS |
4au1-assembly1_A |
1.00 | 0.97 | 4.8e-24 sig | 4au1-assembly1_A Crystal Structure of CobH (precorrin-8x methyl mutase) complexed with C5 desmethyl-HBA |
5n0g-assembly1_A-2 |
1.00 | 0.97 | 2.2e-23 sig | 5n0g-assembly1_A-2 Crystal Structure of CobH T85A (precorrin-8x methyl mutase) complexed with C5 allyl-HBA |
2afv-assembly1_A |
1.00 | 0.91 | 3.2e-16 sig | 2afv-assembly1_A The Crystal Structure of Putative Precorrin Isomerase CbiC in Cobalamin Biosynthesis |
Foldseek search of the AlphaFold DB model (mean pLDDT 97.5, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Catalytic-site verification (M-CSA on the structural model) active site conserved
| M-CSA entry | 193 · EC 5.4.99.61 |
|---|---|
| Catalytic residues | 1/1 identical (1/1 aligned) |
| Verdict | ACTIVE-SITE CONSERVED (1/1 catalytic residues identical) -> likely active enzyme |
Catalytic residues of the matched M-CSA reference enzyme mapped onto the structural model by alignment. An active-site-conserved verdict upgrades a mere fold match to a likely active enzyme; fold-only flags a shared fold whose catalytic machinery is not retained (a guard against over-calling).
Genomic context (neighbours & predicted operon) operon of 5
| Upstream (5' on genome) | cobG (+ strand, 9 bp gap) |
|---|---|
| Downstream (3' on genome) | cobIJ (+ strand, -4 bp gap) |
| Predicted operon |
mazE7 · mazF7 · cobG · cobH · cobIJ
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: cobIJ (bifunctional S-adenosyl-L-methionine-precorrin-2 methyl transferase/precorrin-3 methylase), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2066 cobIJ |
bifunctional S-adenosyl-L-methionine-precorrin-2 methyl transferase/precorrin-3 methylase | 999 | 1000 ctx | neighborhood:881 fusion:897 cooccurence:774 coexpression:982 textmining:554 |
Rv2072c cobL exp |
precorrin-6Y C(5,15)-methyltransferase | 999 | 999 ctx | cooccurence:774 coexpression:972 database:900 textmining:578 |
Rv2848c cobB exp |
cobyrinic acid A,C-diamide synthase | 997 | 994 ctx | fusion:547 cooccurence:767 coexpression:408 database:900 textmining:653 |
Rv2064 cobG |
precorrin-3B synthase | 998 | 992 ctx | neighborhood:876 fusion:806 cooccurence:665 textmining:818 |
Rv0255c cobQ1 |
cobyric acid synthase | 977 | 970 ctx | fusion:589 cooccurence:650 coexpression:778 |
Rv2071c cobM |
precorrin-4 C(11)-methyltransferase | 979 | 959 ctx | cooccurence:772 coexpression:799 textmining:511 |
Rv2070c cobK |
precorrin-6A reductase | 986 | 949 ctx | cooccurence:774 coexpression:753 textmining:746 |
Rv2062c cobN |
cobalamin biosynthesis protein CobN | 935 | 897 ctx | neighborhood:633 cooccurence:696 textmining:400 |
Rv2236c cobD |
cobalamin biosynthesis transmembrane protein CobD | 900 | 870 ctx | cooccurence:732 coexpression:458 |
Rv2063A mazF7 |
mRNA interferase MazF7 | 867 | 867 ctx | neighborhood:867 |
Rv2063 mazE7 |
antitoxin MazE7 | 772 | 772 ctx | neighborhood:770 |
Rv2208 cobS |
adenosylcobinamide-GDP ribazoletransferase | 890 | 720 ctx | cooccurence:448 coexpression:446 textmining:626 |
Rv2423 hyp |
hypothetical protein | 727 | 691 | coexpression:673 |
Rv0254c cobU |
bifunctional cobinamide kinase/cobinamide phosphate guanylyltransferase | 881 | 673 ctx | cooccurence:427 textmining:654 |
Rv2849c cobO |
cob(I)alamin adenosyltransferase | 850 | 493 ctx | cooccurence:404 textmining:717 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: precorrin-8X methylmutase
- MTBC0 PGAP product: precorrin-8X methylmutase
- Pfam (hmmscan --cut_ga): CbiC PF02570.21 (E=5e-68)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216581.1)
- Domains: Pfam-A via hmmscan --cut_ga — CbiC (PF02570.21)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2082 - Curated reference: UniProt P9WP87 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 97.5)
- Catalytic-site verification: M-CSA (Ribeiro et al. 2018, doi:10.1093/nar/gkx1012), entry 193; catalytic residues aligned onto the structural model
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
42 functional partner(s); context anchor
cobIJ - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002199|Rv2065|cobH MLDYLRDAAEIYRRSFAVIRAEADLARFPADVARVVVRLIHTCGQVDVAEHVAYTDDVVARAGAALAAGAPVLCDSSMVAAGITTSRLPADNQIVSLVADPRATELAARRQTTRSAAGVELCAERLPGAVLAIGNAPTALFRLLELVDEGAPPPAAVLGGPVGFVGSAQAKEELIERPRGMSYLVVRGRRGGSAMAAAAVNAIASDRE
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for cobH? Email the maintainer — the message is pre-filled with this gene's details.