cobH Resolved · high auto-curated

H37Rv Rv2065 · MTBC0 mtbc0_002199 · 208 aa · 2351165–2351791 (+) · RefSeq NP_216581.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)precorrin-8X methylmutase
MTBC0 PGAP re-annotationprecorrin-8X methylmutase
Revised (this work)Precorrin-8X methylmutase. Pfam: CbiC (PF02570.21).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WP87 SwissProt · reviewed · Evidence at protein level
UniProt namePrecorrin-8X methylmutase
EC (curated) EC 5.4.99.61
Curated functionCatalyzes the conversion of precorrin-8X to hydrogenobyrinate.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
Preferred namecobH
eggNOG descriptionPrecorrin-8X methylmutase
Orthologous groupCOG2082
EC number EC 5.4.99.60, EC 5.4.99.61
KEGG orthology K06042
KEGG pathways map00860, map01100

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.092 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 13 synonymous, 2 missense, 1 nonsense, 3 frameshift
Disruption 4 distinct premature-stop/frameshift site(s); most common in 0.59% of strains (852) · convergent

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
CbiCPF02570.21 4.9e-6810–204 Precorrin-8X methylmutase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: cobIJ (bifunctional S-adenosyl-L-methionine-precorrin-2 methyl transferase/precorrin-3 methylase), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2066 cobIJ bifunctional S-adenosyl-L-methionine-precorrin-2 methyl transferase/precorrin-3 methylase 999 1000 ctx neighborhood:881 fusion:897 cooccurence:774 coexpression:982 textmining:554
Rv2072c cobL precorrin-6Y C(5,15)-methyltransferase 999 999 ctx cooccurence:774 coexpression:972 database:900 textmining:578
Rv2848c cobB cobyrinic acid A,C-diamide synthase 997 994 ctx fusion:547 cooccurence:767 coexpression:408 database:900 textmining:653
Rv2064 cobG precorrin-3B synthase 998 992 ctx neighborhood:876 fusion:806 cooccurence:665 textmining:818
Rv0255c cobQ1 cobyric acid synthase 977 970 ctx fusion:589 cooccurence:650 coexpression:778
Rv2071c cobM precorrin-4 C(11)-methyltransferase 979 959 ctx cooccurence:772 coexpression:799 textmining:511
Rv2070c cobK precorrin-6A reductase 986 949 ctx cooccurence:774 coexpression:753 textmining:746
Rv2062c cobN cobalamin biosynthesis protein CobN 935 897 ctx neighborhood:633 cooccurence:696 textmining:400
Rv2236c cobD cobalamin biosynthesis transmembrane protein CobD 900 870 ctx cooccurence:732 coexpression:458
Rv2063A mazF7 mRNA interferase MazF7 867 867 ctx neighborhood:867
Rv2063 mazE7 antitoxin MazE7 772 772 ctx neighborhood:770
Rv2208 cobS adenosylcobinamide-GDP ribazoletransferase 890 720 ctx cooccurence:448 coexpression:446 textmining:626
Rv2423 hyp hypothetical protein 727 691 coexpression:673
Rv0254c cobU bifunctional cobinamide kinase/cobinamide phosphate guanylyltransferase 881 673 ctx cooccurence:427 textmining:654
Rv2849c cobO cob(I)alamin adenosyltransferase 850 493 ctx cooccurence:404 textmining:717

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: precorrin-8X methylmutase
  • MTBC0 PGAP product: precorrin-8X methylmutase
  • Pfam (hmmscan --cut_ga): CbiC PF02570.21 (E=5e-68)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216581.1)
  • Domains: Pfam-A via hmmscan --cut_ga — CbiC (PF02570.21)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2082
  • Curated reference: UniProt P9WP87 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 42 functional partner(s); context anchor cobIJ
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002199|Rv2065|cobH
MLDYLRDAAEIYRRSFAVIRAEADLARFPADVARVVVRLIHTCGQVDVAEHVAYTDDVVARAGAALAAGAPVLCDSSMVAAGITTSRLPADNQIVSLVADPRATELAARRQTTRSAAGVELCAERLPGAVLAIGNAPTALFRLLELVDEGAPPPAAVLGGPVGFVGSAQAKEELIERPRGMSYLVVRGRRGGSAMAAAAVNAIASDRE