rpmG1 Resolved · high auto-curated

H37Rv Rv2057c · MTBC0 - · 54 aa · 2314661–2314825 (-) · RefSeq YP_177856.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)50S ribosomal protein L33
MTBC0 PGAP re-annotation
Revised (this work)50S ribosomal protein L33. Pfam: Ribosomal_L33 (PF00471.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WH97 SwissProt · reviewed · Inferred from homology
UniProt nameLarge ribosomal subunit protein bL33A

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namerpmG
eggNOG descriptionBelongs to the bacterial ribosomal protein bL33 family
Orthologous groupCOG0267
KEGG orthology K02913
KEGG pathways map03010
KEGG modules M00178
Gene Ontology (22) GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005840, GO:0015934, GO:0022625, GO:0022626, GO:0032991, GO:0043226, GO:0043228 +10 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Ribosomal_L33PF00471.27 8.3e-169–54 Ribosomal protein L33

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rpmB2 (50S ribosomal protein L28), high confidence from genomic context alone (score 999 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1642 rpmI 50S ribosomal protein L35 999 999 coexpression:671 experimental:997
Rv2058c rpmB2 50S ribosomal protein L28 999 999 ctx neighborhood:882 cooccurence:671 coexpression:906 experimental:789 textmining:787
Rv2056c rpsN2 30S ribosomal protein S14 999 997 ctx neighborhood:882 coexpression:771 experimental:870 textmining:831
Rv2055c rpsR2 30S ribosomal protein S18 998 995 ctx neighborhood:882 coexpression:687 experimental:870 textmining:614
Rv0105c rpmB1 50S ribosomal protein L28 993 973 ctx cooccurence:600 coexpression:672 experimental:789 textmining:783
Rv0979A rpmF 50S ribosomal protein L32 984 969 coexpression:722 experimental:829 textmining:525
Rv2442c rplU 50S ribosomal protein L21 973 969 coexpression:730 experimental:870
Rv2441c rpmA 50S ribosomal protein L27 972 969 coexpression:728 experimental:870
Rv0708 rplP 50S ribosomal protein L16 971 968 coexpression:645 experimental:870
Rv1643 rplT 50S ribosomal protein L20 971 968 coexpression:723 experimental:870
Rv0685 tuf elongation factor Tu 969 968 coexpression:706 experimental:829
Rv0056 rplI 50S ribosomal protein L9 970 966 coexpression:708 experimental:870
Rv0651 rplJ 50S ribosomal protein L10 968 966 coexpression:731 experimental:870
Rv0700 rpsJ 30S ribosomal protein S10 968 966 coexpression:731 experimental:870
Rv0701 rplC 50S ribosomal protein L3 967 966 coexpression:731 experimental:870

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): 50S ribosomal protein L33
  • Pfam (hmmscan --cut_ga): Ribosomal_L33 PF00471.27 (E=8e-16)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177856.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Ribosomal_L33 (PF00471.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0267
  • Curated reference: UniProt P9WH97 (SwissProt, reviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 203 functional partner(s); context anchor rpmB2
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2057c|rpmG1
MARTDIRPIVKLRSTAGTGYTYTTRKNRRNDPDRLILRKYDPILRRHVDFREER