fxsA Family assigned · medium auto-curated
H37Rv Rv2053c · MTBC0 mtbc0_002186 ·
175 aa · 2341135–2341662 (-) ·
RefSeq NP_216569.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | transmembrane protein FxsA |
|---|---|
| MTBC0 PGAP re-annotation | FxsA family protein |
| Revised (this work) | FxsA family protein. Pfam: FxsA (PF04186.19). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O53495
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | Probable transmembrane protein FxsA |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| Preferred name | fxsA |
| eggNOG description | FxsA cytoplasmic membrane protein |
| Orthologous group | COG3030 |
| KEGG orthology |
K07113
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.414 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 1 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.18% of strains (256) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
FxsA | PF04186.19 | 1.7e-17 | 4–109 | FxsA cytoplasmic membrane protein |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: ppm1 (polyprenol-monophosphomannose synthase), high confidence from genomic context alone (score 870 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2052c hyp |
hypothetical protein | 979 | 979 ctx | neighborhood:882 coexpression:831 |
Rv2051c ppm1 |
polyprenol-monophosphomannose synthase | 869 | 870 ctx | neighborhood:534 coexpression:732 |
Rv2054 hyp |
hypothetical protein | 787 | 787 ctx | neighborhood:784 |
Rv2710 sigB |
RNA polymerase sigma factor SigB | 778 | 767 | coexpression:767 |
Rv0983 pepD |
serine protease PepD | 740 | 741 | coexpression:732 |
Rv0251c hsp |
heat shock protein | 550 | 551 | coexpression:551 |
Rv3584 lpqE |
lipoprotein LpqE | 541 | 541 ctx | cooccurence:472 |
Rv2468c hyp |
hypothetical protein | 495 | 496 ctx | cooccurence:495 |
Rv0563 htpX |
protease HtpX | 511 | 491 | coexpression:491 |
Rv0351 grpE |
stress response protein GrpE | 471 | 444 | coexpression:444 |
Rv2744c 35kd_ag hyp |
hypothetical protein | 442 | 443 | |
Rv1471 trxB1 |
thioredoxin | 425 | 425 | coexpression:425 |
Rv2031c hspX |
alpha-crystallin | 424 | 424 | coexpression:424 |
Rv1324 |
thioredoxin | 417 | 417 | coexpression:417 |
Rv3914 trxC |
thioredoxin TrxC | 416 | 417 | coexpression:417 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: transmembrane protein FxsA
- MTBC0 PGAP product: FxsA family protein
- Pfam (hmmscan --cut_ga): FxsA PF04186.19 (E=2e-17)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216569.1)
- Domains: Pfam-A via hmmscan --cut_ga — FxsA (PF04186.19)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG3030 - Curated reference: UniProt O53495 (TrEMBL, unreviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
19 functional partner(s); context anchor
ppm1 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002186|Rv2053c|fxsA MSRLLLSYAVVELAVVFALAATIGFGWTLLVLLATFVLGFGLLAPLGGWQLGRRLLWLRSGLAEPRSALSDGALVTVASVLVLVPGLVTTTMGLLLLVPPIRALARPGLTAIAVRGFLRNVPLTADAAANMAGAFGESGTDPDFIDGEVIDVIDVEPLTLQPPRVAAEPPSPGSN