fxsA Family assigned · medium auto-curated

H37Rv Rv2053c · MTBC0 mtbc0_002186 · 175 aa · 2341135–2341662 (-) · RefSeq NP_216569.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transmembrane protein FxsA
MTBC0 PGAP re-annotationFxsA family protein
Revised (this work)FxsA family protein. Pfam: FxsA (PF04186.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53495 TrEMBL · unreviewed · Predicted
UniProt nameProbable transmembrane protein FxsA

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namefxsA
eggNOG descriptionFxsA cytoplasmic membrane protein
Orthologous groupCOG3030
KEGG orthology K07113

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.414 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.18% of strains (256) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
FxsAPF04186.19 1.7e-174–109 FxsA cytoplasmic membrane protein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: ppm1 (polyprenol-monophosphomannose synthase), high confidence from genomic context alone (score 870 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2052c hyp hypothetical protein 979 979 ctx neighborhood:882 coexpression:831
Rv2051c ppm1 polyprenol-monophosphomannose synthase 869 870 ctx neighborhood:534 coexpression:732
Rv2054 hyp hypothetical protein 787 787 ctx neighborhood:784
Rv2710 sigB RNA polymerase sigma factor SigB 778 767 coexpression:767
Rv0983 pepD serine protease PepD 740 741 coexpression:732
Rv0251c hsp heat shock protein 550 551 coexpression:551
Rv3584 lpqE lipoprotein LpqE 541 541 ctx cooccurence:472
Rv2468c hyp hypothetical protein 495 496 ctx cooccurence:495
Rv0563 htpX protease HtpX 511 491 coexpression:491
Rv0351 grpE stress response protein GrpE 471 444 coexpression:444
Rv2744c 35kd_ag hyp hypothetical protein 442 443
Rv1471 trxB1 thioredoxin 425 425 coexpression:425
Rv2031c hspX alpha-crystallin 424 424 coexpression:424
Rv1324 thioredoxin 417 417 coexpression:417
Rv3914 trxC thioredoxin TrxC 416 417 coexpression:417

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transmembrane protein FxsA
  • MTBC0 PGAP product: FxsA family protein
  • Pfam (hmmscan --cut_ga): FxsA PF04186.19 (E=2e-17)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216569.1)
  • Domains: Pfam-A via hmmscan --cut_ga — FxsA (PF04186.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3030
  • Curated reference: UniProt O53495 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 19 functional partner(s); context anchor ppm1
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002186|Rv2053c|fxsA
MSRLLLSYAVVELAVVFALAATIGFGWTLLVLLATFVLGFGLLAPLGGWQLGRRLLWLRSGLAEPRSALSDGALVTVASVLVLVPGLVTTTMGLLLLVPPIRALARPGLTAIAVRGFLRNVPLTADAAANMAGAFGESGTDPDFIDGEVIDVIDVEPLTLQPPRVAAEPPSPGSN