Rv2067c Resolved · high auto-curated

H37Rv Rv2067c · MTBC0 mtbc0_002201 · 407 aa · 2353260–2354483 (-) · RefSeq NP_216583.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationclass I SAM-dependent methyltransferase
Revised (this work)Class I SAM-dependent methyltransferase. Pfam: Methyltransf_9 (PF08003.18), Methyltransf_25 (PF13649.13), Methyltransf_31 (PF13847.13), Methyltransf_12 (PF08242.19), Methyltransf_11 (PF08241.19), Methyltransf_23 (PF13489.13).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WLL9 SwissProt · reviewed · Evidence at protein level
UniProt nameS-adenosyl-L-methionine-dependent methyltransferase Rv2067c
EC (curated) EC 2.1.1.360
Curated functionInvolved in epigenetic reprogramming of the human host cells for the benefit of intracellular survival of the pathogen. Trimethylates 'Lys-79' of human histone H3 forming the so called H3K79me3 mark in the THP-1 macrophages upon M.tuberculosis infection. Acts specifically on free non-nucleosomal histone H3. Alters gene expression of the macrophage post-infection by adding the H3K79me3 mark on genes involved in defense response to increase pathogenesis. Represses methyltransferase DOT1L resulting in reduction of DOT1L-specific nucleosomal H3K79me3 mark and thus in reduced expression of pro-infl.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category Q Secondary metabolites biosynthesis, transport and catabolism
eggNOG descriptionMethyltransferase domain
Orthologous groupCOG0500
Gene Ontology (20) GO:0003674, GO:0003824, GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0005886, GO:0008150, GO:0008152, GO:0008168, GO:0008757 +8 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.368 · purifying
Polymorphic sites (≥ 0.1% of strains) 7 synonymous, 7 missense, 1 nonsense, 0 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.22% of strains (321) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Methyltransf_9PF08003.18 1.4e-0558–155 Protein of unknown function (DUF1698)
Methyltransf_25PF13649.13 2.2e-1259–153 Methyltransferase domain
Methyltransf_31PF13847.13 3.7e-1259–156 Methyltransferase domain
Methyltransf_12PF08242.19 9.0e-1662–155 Methyltransferase domain
Methyltransf_11PF08241.19 1.5e-1362–156 Methyltransferase domain
Methyltransf_23PF13489.13 1.8e-0762–157 Methyltransferase domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: blaC (beta-lactamase), high confidence from genomic context alone (score 777 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2068c blaC beta-lactamase 778 777 ctx neighborhood:772
Rv2423 hyp hypothetical protein 776 777 ctx cooccurence:773
Rv3899c hyp hypothetical protein 748 748 ctx cooccurence:748
Rv3435c transmembrane protein 740 741 ctx cooccurence:737
Rv3887c eccD2 ESX-2 secretion system protein EccD 708 709 ctx cooccurence:707
Rv2079 hyp hypothetical protein 678 678 ctx cooccurence:676
Rv1359 transcriptional regulator 668 669 ctx cooccurence:667
Rv3166c hyp hypothetical protein 668 668 ctx cooccurence:667
Rv0048c membrane protein 668 668 ctx cooccurence:668
Rv1795 eccD5 ESX-5 type VII secretion system protein EccD 624 624 ctx cooccurence:622
Rv2939 papA5 phthiocerol/phthiodiolone dimycocerosyl transferase 607 607 ctx cooccurence:603
Rv3843c transmembrane protein 598 598 ctx cooccurence:597
Rv2387 hyp hypothetical protein 567 567 ctx cooccurence:565
Rv1816 HTH-type transcriptional regulator 565 566 ctx cooccurence:560
Rv0977 PE_PGRS16 PE-PGRS family protein PE_PGRS16 563 563 ctx cooccurence:563

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: class I SAM-dependent methyltransferase
  • Pfam (hmmscan --cut_ga): Methyltransf_9 PF08003.18 (E=1e-05), Methyltransf_25 PF13649.13 (E=2e-12), Methyltransf_31 PF13847.13 (E=4e-12), Methyltransf_12 PF08242.19 (E=9e-16), Methyltransf_11 PF08241.19 (E=1e-13), Methyltransf_23 PF13489.13 (E=2e-07)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216583.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Methyltransf_9 (PF08003.18), Methyltransf_25 (PF13649.13), Methyltransf_31 (PF13847.13), Methyltransf_12 (PF08242.19), Methyltransf_11 (PF08241.19), Methyltransf_23 (PF13489.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0500
  • Curated reference: UniProt P9WLL9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 46 functional partner(s); context anchor blaC
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002201|Rv2067c|
MTDDHPRADIVSRQYHRWLYPHPIADLEAWTTANWEWFDPVHSHRILWPDREYRPDLDILIAGCGTNQAAIFAFTNRAAKVVAIDISRPALDHQQYLKDKHGLANLELHLLPIEELATLGRDFDLVVSTGVLHHLADPRAGMKELAHCLRRDGVVAAMLYGKYGRIGVELLGSVFRDLGLGQDDASIKLAKEAISLLPTYHPLRNYLTKARDLLSDSALVDTFLHGRQRSYTVEECVDLVTSAGLVFQGWFHKAPYYPHDFFVPNSEFYAAVNTLPEVKAWSVMERLETLNATHLFMACRRDRPKEQYTIDFSTVAALDYVPLMRTRCGVSGTDMFWPGWRMAPSPAQLAFLQQVDGRRTIREIAGCVARTGEPSGGSLADLEEFGRKLFQSLWRLDFVAVALPASG