Rv1752 Family assigned · medium auto-curated

H37Rv Rv1752 · MTBC0 - · 149 aa · 1981130–1981579 (+) · RefSeq NP_216268.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Contains GFO_IDH_MocA_C3 (PF22725.2) domain(s); putative function inferred from the domain architecture.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt O06789 TrEMBL · unreviewed · Predicted
UniProt nameGFO/IDH/MocA-like oxidoreductase domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionOxidoreductase
Orthologous groupCOG0673

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.236 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
GFO_IDH_MocA_C3PF22725.2 1.0e-081–74 GFO/IDH/MocA C-terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1751 (oxidoreductase), high confidence from genomic context alone (score 787 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0498 hyp hypothetical protein 902 873 coexpression:863
Rv0310c hyp hypothetical protein 819 808 database:797
Rv0620 galK galactokinase 831 803 experimental:768
Rv1751 oxidoreductase 972 787 ctx neighborhood:759 textmining:878
Rv1904 hyp hypothetical protein 750 750 ctx cooccurence:748
Rv2843 hyp hypothetical protein 697 698 ctx cooccurence:695
Rv1640c lysX bifunctional lysine--tRNA ligase/phosphatidylglycerol lysyltransferase 686 686 coexpression:660
Rv3598c lysS lysine--tRNA ligase 680 680 coexpression:662
Rv3784 dTDP-glucose 4,6-dehydratase 686 664 coexpression:645
Rv3464 rmlB dTDP-glucose 4,6-dehydratase 685 663 coexpression:644
Rv2164c hyp hypothetical protein 659 660 ctx cooccurence:656
Rv1365c rsfA anti-sigma-F factor antagonist RsfA 611 612 ctx cooccurence:607
Rv1389 gmk guanylate kinase 608 609 database:554
Rv2939 papA5 phthiocerol/phthiodiolone dimycocerosyl transferase 593 593 ctx cooccurence:593
Rv0977 PE_PGRS16 PE-PGRS family protein PE_PGRS16 578 579 ctx cooccurence:571

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Pfam (hmmscan --cut_ga): GFO_IDH_MocA_C3 PF22725.2 (E=1e-08)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216268.1)
  • Domains: Pfam-A via hmmscan --cut_ga — GFO_IDH_MocA_C3 (PF22725.2)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0673
  • Curated reference: UniProt O06789 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 80 functional partner(s); context anchor Rv1751
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1752|
MDAGCYAVHMAHTFGGATPEVVSAQAKLRDPAVDRAMTAELKFPGGHTGGIRCSMRSSDLLNVSARVVGDRGELRVLNPVVPQLFHRLPPLACVSARRFRCRSAARASGQDDAQGRGREHERDPRDLSGRRAPIAQPELNMVAASGSAA