Rv1752 Family assigned · medium auto-curated
H37Rv Rv1752 · MTBC0 - ·
149 aa · 1981130–1981579 (+) ·
RefSeq NP_216268.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Contains GFO_IDH_MocA_C3 (PF22725.2) domain(s); putative function inferred from the domain architecture. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
O06789
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | GFO/IDH/MocA-like oxidoreductase domain-containing protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Oxidoreductase |
| Orthologous group | COG0673 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.236 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
GFO_IDH_MocA_C3 | PF22725.2 | 1.0e-08 | 1–74 | GFO/IDH/MocA C-terminal domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv1751 (oxidoreductase), high confidence from genomic context alone (score 787 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0498 hyp |
hypothetical protein | 902 | 873 | coexpression:863 |
Rv0310c hyp |
hypothetical protein | 819 | 808 | database:797 |
Rv0620 galK |
galactokinase | 831 | 803 | experimental:768 |
Rv1751 |
oxidoreductase | 972 | 787 ctx | neighborhood:759 textmining:878 |
Rv1904 hyp |
hypothetical protein | 750 | 750 ctx | cooccurence:748 |
Rv2843 hyp |
hypothetical protein | 697 | 698 ctx | cooccurence:695 |
Rv1640c lysX |
bifunctional lysine--tRNA ligase/phosphatidylglycerol lysyltransferase | 686 | 686 | coexpression:660 |
Rv3598c lysS |
lysine--tRNA ligase | 680 | 680 | coexpression:662 |
Rv3784 |
dTDP-glucose 4,6-dehydratase | 686 | 664 | coexpression:645 |
Rv3464 rmlB |
dTDP-glucose 4,6-dehydratase | 685 | 663 | coexpression:644 |
Rv2164c hyp |
hypothetical protein | 659 | 660 ctx | cooccurence:656 |
Rv1365c rsfA |
anti-sigma-F factor antagonist RsfA | 611 | 612 ctx | cooccurence:607 |
Rv1389 gmk |
guanylate kinase | 608 | 609 | database:554 |
Rv2939 papA5 |
phthiocerol/phthiodiolone dimycocerosyl transferase | 593 | 593 ctx | cooccurence:593 |
Rv0977 PE_PGRS16 |
PE-PGRS family protein PE_PGRS16 | 578 | 579 ctx | cooccurence:571 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
- Pfam (hmmscan --cut_ga): GFO_IDH_MocA_C3 PF22725.2 (E=1e-08)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216268.1)
- Domains: Pfam-A via hmmscan --cut_ga — GFO_IDH_MocA_C3 (PF22725.2)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0673 - Curated reference: UniProt O06789 (TrEMBL, unreviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
80 functional partner(s); context anchor
Rv1751 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv1752| MDAGCYAVHMAHTFGGATPEVVSAQAKLRDPAVDRAMTAELKFPGGHTGGIRCSMRSSDLLNVSARVVGDRGELRVLNPVVPQLFHRLPPLACVSARRFRCRSAARASGQDDAQGRGREHERDPRDLSGRRAPIAQPELNMVAASGSAA