fadB5 Family assigned · medium auto-curated

H37Rv Rv1912c · MTBC0 mtbc0_002027 · 334 aa · 2176197–2177201 (-) · RefSeq NP_216428.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)oxidoreductase FadB
MTBC0 PGAP re-annotationmedium chain dehydrogenase/reductase family protein
Revised (this work)Medium chain dehydrogenase/reductase family protein. Pfam: ADH_N (PF08240.18), ADH_zinc_N (PF00107.33), ADH_zinc_N_2 (PF13602.13).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O07721 TrEMBL · unreviewed · Evidence at protein level
UniProt namePossible oxidoreductase FadB5

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
Preferred namefadB5
eggNOG descriptionThought to be involved in fatty acid degradation. FadB and FadA are the alpha and beta subunits of the multifunctional enzyme complex of the fatty acid degradation cycle
Orthologous groupCOG0604
EC number EC 1.6.5.5
KEGG orthology K00344

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.455 · purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 4 missense, 1 nonsense, 3 frameshift
Disruption 4 distinct premature-stop/frameshift site(s); most common in 17.63% of strains (25606) · convergent

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ADH_NPF08240.18 2.3e-1327–107 Alcohol dehydrogenase GroES-like domain
ADH_zinc_NPF00107.33 5.3e-18152–262 Zinc-binding dehydrogenase
ADH_zinc_N_2PF13602.13 1.7e-17184–332 Zinc-binding dehydrogenase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mbtC (polyketide synthetase), high confidence from genomic context alone (score 913 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2382c mbtC polyketide synthetase 914 913 ctx fusion:897
Rv1663 pks17 polyketide synthase 911 907 ctx fusion:888
Rv1180 pks3 polyketide beta-ketoacyl synthase 906 906 ctx fusion:888
Rv2947c pks15 polyketide synthase 905 905 ctx fusion:887
Rv1664 pks9 polyketide synthase 891 890 ctx fusion:869
Rv0405 pks6 membrane bound polyketide synthase 756 744 ctx fusion:686
Rv1913 hyp hypothetical protein 659 659 ctx neighborhood:654
Rv1911c lppC lipoprotein LppC 860 595 ctx neighborhood:584 textmining:669
Rv2932 ppsB phthiocerol synthesis polyketide synthase type I PpsB 597 571 ctx fusion:461
Rv1910c hyp hypothetical protein 893 478 ctx neighborhood:464 textmining:804
Rv2935 ppsE phthiocerol synthesis polyketide synthase type I PpsE 444 441
Rv2931 ppsA phthiocerol synthesis polyketide synthase type I PpsA 461 434
Rv3800c pks13 polyketide synthase 421 343
Rv1909c furA ferric uptake regulation protein FurA 425 308
Rv3141 fadB4 NADPH quinone oxidoreductase FadB 497 298

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: oxidoreductase FadB
  • MTBC0 PGAP product: medium chain dehydrogenase/reductase family protein
  • Pfam (hmmscan --cut_ga): ADH_N PF08240.18 (E=2e-13), ADH_zinc_N PF00107.33 (E=5e-18), ADH_zinc_N_2 PF13602.13 (E=2e-17)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216428.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ADH_N (PF08240.18), ADH_zinc_N (PF00107.33), ADH_zinc_N_2 (PF13602.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0604
  • Curated reference: UniProt O07721 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 23 functional partner(s); context anchor mbtC
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002027|Rv1912c|fadB5
MRAVVITKHGDPSVLQVRQRPDPPPPGPGQLRVAVRAAGVNFADHLARVGLYPDAPKLPAVVGYEVAGTVEAVGDGVDPNRVGERVLAGTRFGGYCEIVNVAATDSVVLPDALSFEQGAAVPVNYATAWAALHGYGSLRAGERVLIHAAAGGVGIAAVQFAKAAKAEVHGTASPQKHQKLAEFGVDRAIDYRRDGWWQGLGPYDVVLDALGGTSLRRSYTLLRPGGRLVGYGISNMQHGEKRSMRRVAPHALSMLRGFNLMKQLEESKTVIGLNMLRLWDDRRTLEPWIAPLTKALNDGTILPIVHAIVPFAEAPEAHRILAARENVGKVVLVP