Rv3899c Family assigned · medium

H37Rv Rv3899c · MTBC0 - · 410 aa · 4384147–4385379 (-) · RefSeq NP_218416.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Secreted protein (found in culture filtrate), conserved across mycobacteria, with an X-ray crystal structure of fragment 184-410 that defines a new protein family (an alpha/beta/alpha sandwich + alpha-helix bundle; no structures for homologues previously known). Immunoglobulin-like, candidate vaccine antigen. Molecular function unknown. (UniProt auto-name 'Tat' is a database artefact and is not adopted.)

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt O05446 TrEMBL · unreviewed · Evidence at protein level
UniProt nameTat

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2A1TI

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.315 · purifying
Polymorphic sites (≥ 0.1% of strains) 35 synonymous, 27 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 25.75% of strains (37389) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF5632PF18646.7 3.1e-32195–276 Family of unknown function (DUF5632)
DUF5631PF18645.7 3.7e-34304–397 Family of unknown function (DUF5631)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: eccD2 (ESX-2 secretion system protein EccD), high confidence from genomic context alone (score 880 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3887c eccD2 ESX-2 secretion system protein EccD 879 880 ctx cooccurence:772 coexpression:430
Rv3895c eccB2 ESX-2 secretion system protein EccB 830 824 ctx cooccurence:739
Rv3894c eccC2 ESX-2 type VII secretion system protein EccC 784 785 ctx cooccurence:689
Rv3900c hyp hypothetical protein 969 775 ctx neighborhood:774 textmining:870
Rv2423 hyp hypothetical protein 772 772 ctx cooccurence:771
Rv0977 PE_PGRS16 PE-PGRS family protein PE_PGRS16 778 770 ctx cooccurence:688
Rv3166c hyp hypothetical protein 758 758 ctx cooccurence:758
Rv0256c PPE2 PPE family protein PPE2 748 749 ctx cooccurence:747
Rv2067c hyp hypothetical protein 748 748 ctx cooccurence:748
Rv1435c hyp hypothetical protein 745 746 ctx cooccurence:744
Rv2079 hyp hypothetical protein 738 739 ctx cooccurence:728
Rv3446c hyp hypothetical protein 738 739 ctx cooccurence:735
Rv1006 hyp hypothetical protein 738 739 ctx cooccurence:737
Rv3435c transmembrane protein 727 728 ctx cooccurence:725
Rv3448 eccD4 ESX-4 secretion system protein EccD4 724 725 ctx cooccurence:533 coexpression:432

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Crystal structure of fragment 184-410; first structure of a new protein family (Liu 2016, PMID 27487929)
  • Secreted (culture filtrate); immunoglobulin-like fold; interacts with ESX-2 / PE-PPE (Das 2021, PMID 34228167)
  • Curated from the literature crible (project 'Still unknown gene function', 2026-06-09)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218416.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF5632 (PF18646.7), DUF5631 (PF18645.7)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2A1TI
  • Curated reference: UniProt O05446 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 120 functional partner(s); context anchor eccD2
  • Primary literature: Liu Y, Gao Y, Li D, Fleming J, Li H, Bi L (2016). Crystal structure of Rv3899c(184-410), a hypothetical protein from Mycobacterium tuberculosis Acta Crystallogr F 72(Pt 8):642-5. doi:10.1107/S2053230X16010943 PMID:27487929
  • Primary literature: Das R, Eniyan K, Bajpai U (2021). Computational identification and characterization of antigenic properties of Rv3899c of Mycobacterium tuberculosis and its interaction with human leukocyte antigen (HLA) Immunogenetics 73(5):357-368. doi:10.1007/s00251-021-01220-x PMID:34228167

Ancestral MTBC0 protein sequence

>H37Rv|Rv3899c|
MVTGQPAAAGAHSLSEGAMTAMQSGSVPPPQATPPITTPPVVSAPTMAAGIEATHGPVDTPANTSGAPPASTGTTGPVAPTVVTAGPVAAPAAPVVGGSAVPAGPLPAYGSDLRPPVVAAPAVPSVPTAPVSGAPVAPSASSAPSAGGALVSPVERAASKAVAGQAGASSSTMAGASALSATAGATAGAVSARAAEQQRLQRIVDAVARQEPRISWAAGLRDDGTTTLLVTDLAGGWIPPHVRLPANVTLLEPTARRRDADVIDLLGAVVAVAAHESNTYVAEPGPDAPALTGDRSARSAIPKVDEFGPTLVEAVRRRDSLPRIAQAIALPAVRKTGVLENEAELLHGCITAVKESVLKAYPSHELTAVGDWMLLAAIEALIDEQDYLANYHLAWYAVTTRRGGSRGFAA