Rv1914c Still unknown · low auto-curated
H37Rv Rv1914c · MTBC0 mtbc0_002029 ·
135 aa · 2178031–2178438 (-) ·
RefSeq NP_216430.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | hypothetical protein |
| Revised (this work) | Conserved hypothetical protein; no recognised domain. Function unknown. Foldseek best (non-significant) hit: 2ys5-assembly1_A Solution structure of the complex of the PTB domain o (prob 0.38, TM 0.51). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O07719
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Uncharacterized protein |
UniProt still lists this protein as Uncharacterized protein; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| Orthologous group | 2CK29 |
|---|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 3 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.18% of strains (256) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Structural neighbours (Foldseek on the ESMFold model, exploratory)
ESMFold model confidence: mean pLDDT 71.8 (confident). A confident model makes the fold comparison meaningful.
Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.
| Target | Prob | TM | E-value | Description |
|---|---|---|---|---|
2ys5-assembly1_A |
0.38 | 0.51 | 5.5e-01 | 2ys5-assembly1_A Solution structure of the complex of the PTB domain of SNT-2 and 19-residue peptide (aa 1571-1589) of hALK |
8emv-assembly1_A |
0.38 | 0.40 | 1.4e-01 | 8emv-assembly1_A Phospholipase C beta 3 (PLCb3) in solution |
4qj3-assembly1_B |
0.33 | 0.44 | 3.6e-01 | 4qj3-assembly1_B Structure of a fragment of human phospholipase C-beta3 delta472-559, in complex with Galphaq |
4qj5-assembly1_B |
0.30 | 0.43 | 3.0e-01 | 4qj5-assembly1_B Structure of a fragment of human phospholipase C-beta3 delta472-581, bound to IP3 and in complex with Galphaq |
8uqo-assembly1_Q |
0.25 | 0.41 | 4.1e-01 | 8uqo-assembly1_Q PLCb3-Gbg-Gaq complex on membranes |
4qj4-assembly1_B |
0.23 | 0.43 | 4.9e-01 | 4qj4-assembly1_B Structure of a fragment of human phospholipase C-beta3 delta472-569, bound to IP3 and in complex with Galphaq |
2p1r-assembly2_D |
0.21 | 0.50 | 5.2e-01 | 2p1r-assembly2_D Crystal structure of Salmonella typhimurium YegS, a putative lipid kinase homologous to eukaryotic sphingosine and diacylglycerol kinases. |
4gnk-assembly2_D |
0.20 | 0.39 | 3.6e-01 | 4gnk-assembly2_D Crystal structure of Galphaq in complex with full-length human PLCbeta3 |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: aceAb (isocitrate lyase AceAb), medium confidence from genomic context alone (score 554 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1916 aceAb |
isocitrate lyase AceAb | 554 | 554 ctx | neighborhood:552 |
Rv1915 aceAa |
isocitrate lyase AceAa | 552 | 552 ctx | neighborhood:552 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: hypothetical protein
- Foldseek best: 2ys5-assembly1_A Solution structure of the complex of the PTB domain of SNT-2 an (prob 0.38, E=5e-01, TM=0.51)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216430.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2CK29 - Curated reference: UniProt O07719 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Model confidence: ESMFold per-residue pLDDT (mean 71.8, confident)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
2 functional partner(s); context anchor
aceAb - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002029|Rv1914c| MVLSRTSTGRVILVPTQLRFDRWFLPLAVPLGLGPKNSELWVGAGSLHVKMGWAFAADIPLTSITKAEATNARVYAAGVHFGFGRWLVNGSRKGLVALTIDPPEQAKMWKKSMTVRELWVSVTDPDALVTACTAK