Rv1903 Family assigned · medium auto-curated

H37Rv Rv1903 · MTBC0 mtbc0_002018 · 134 aa · 2168474–2168878 (+) · RefSeq NP_216419.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)membrane protein
MTBC0 PGAP re-annotationphage holin family protein
Revised (this work)Phage holin family protein. Pfam: Phage_holin_4_2 (PF04020.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O07729 TrEMBL · unreviewed · Predicted
UniProt nameProbable conserved membrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionmembrane
Orthologous groupCOG1950
KEGG orthology K08972

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.083 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Phage_holin_4_2PF04020.19 1.9e-274–119 Mycobacterial 4 TMS phage holin, superfamily IV

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: nanT (sialic acid-transport integral membrane protein NanT), medium confidence from genomic context alone (score 620 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1902c nanT sialic acid-transport integral membrane protein NanT 620 620 ctx neighborhood:612
Rv1904 hyp hypothetical protein 839 558 ctx neighborhood:553 textmining:652
Rv0944 fpg2 formamidopyrimidine-DNA glycosylase 556 557 ctx neighborhood:544
Rv0945 oxidoreductase 546 547 ctx neighborhood:544
Rv1001 arcA arginine deiminase 409 409 coexpression:409
Rv1912c fadB5 oxidoreductase FadB 812 83 textmining:804
Rv1905c aao D-amino acid oxidase 806 58 textmining:803
Rv1906c hyp hypothetical protein 870 47 textmining:870
Rv1910c hyp hypothetical protein 870 45 textmining:870
Rv1911c lppC lipoprotein LppC 808 44 textmining:808
Rv1907c hyp hypothetical protein 807 41 textmining:807

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: membrane protein
  • MTBC0 PGAP product: phage holin family protein
  • Pfam (hmmscan --cut_ga): Phage_holin_4_2 PF04020.19 (E=2e-27)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216419.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Phage_holin_4_2 (PF04020.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1950
  • Curated reference: UniProt O07729 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 11 functional partner(s); context anchor nanT
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002018|Rv1903|
MVPFLMRAAVTGFALWVVTLFVPGMRFAGGDTTLQRVAIIFVVAVIFGLVNAFIKPIVQILSIPLYILTLGLFHVVVNASMLWLTAWITEHTTHWGLQIDHFWWTAIWAAILLSIVSWILSLLARDFRRVTRAH