lppC Family assigned · medium auto-curated

H37Rv Rv1911c · MTBC0 mtbc0_002026 · 201 aa · 2175492–2176097 (-) · RefSeq NP_216427.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)lipoprotein LppC
MTBC0 PGAP re-annotationYbhB/YbcL family Raf kinase inhibitor-like protein
Revised (this work)YbhB/YbcL family Raf kinase inhibitor-like protein. Pfam: PBP (PF01161.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WFN3 SwissProt · reviewed · Evidence at protein level
UniProt namePutative lipoprotein LppC
Curated functionProbably involved in bacterial recognition and uptake by its host (human).

UniProt still lists this protein as Putative lipoprotein LppC; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namelppC
eggNOG descriptionPhosphatidylethanolamine-binding protein
Orthologous groupCOG1881
KEGG orthology K06910
Gene Ontology (7) GO:0005575, GO:0005576, GO:0005618, GO:0005623, GO:0030312, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.566 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PBPPF01161.26 1.9e-3169–199 Phosphatidylethanolamine-binding protein

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv0708 rplP 50S ribosomal protein L16 866 861 experimental:784
Rv0704 rplB 50S ribosomal protein L2 840 834 experimental:779
Rv2890c rpsB 30S ribosomal protein S2 832 832 experimental:783
Rv3443c rplM 50S ribosomal protein L13 828 822 experimental:783
Rv0721 rpsE 30S ribosomal protein S5 818 819 experimental:783
Rv2785c rpsO 30S ribosomal protein S15 818 818 experimental:783
Rv3461c rpmJ 50S ribosomal protein L36 823 817 experimental:785
Rv0979A rpmF 50S ribosomal protein L32 815 816 experimental:786
Rv2441c rpmA 50S ribosomal protein L27 823 815 experimental:787
Rv2904c rplS 50S ribosomal protein L19 820 809 experimental:787
Rv2909c rpsP 30S ribosomal protein S16 808 806 experimental:785
Rv3442c rpsI 30S ribosomal protein S9 805 806 experimental:785
Rv3456c rplQ 50S ribosomal protein L17 811 805 experimental:785
Rv0723 rplO 50S ribosomal protein L15 804 804 experimental:787
Rv0701 rplC 50S ribosomal protein L3 802 803 experimental:785

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: lipoprotein LppC
  • MTBC0 PGAP product: YbhB/YbcL family Raf kinase inhibitor-like protein
  • Pfam (hmmscan --cut_ga): PBP PF01161.26 (E=2e-31)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216427.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PBP (PF01161.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1881
  • Curated reference: UniProt P9WFN3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 105 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002026|Rv1911c|lppC
MTSTLHRTPLATAGLALVVALGGCGGGGGDSRETPPYVPKATTVDATTPAPAAEPLTIASPMFADGAPIPVQFSCKGANVAPPLTWSSPAGAAELALVVDDPDAVGGLYVHWIVTGIAPGSGSTADGQTPAGGHSVPNSGGRQGYFGPCPPAGTGTHHYRFTLYHLPVALQLPPGATGVQAAQAIAQAASGQARLVGTFEG