lppC Family assigned · medium auto-curated
H37Rv Rv1911c · MTBC0 mtbc0_002026 ·
201 aa ·
2175492–2176097 MTBC0
(-) ·
RefSeq NP_216427.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | lipoprotein LppC |
|---|---|
| MTBC0 PGAP re-annotation | YbhB/YbcL family Raf kinase inhibitor-like protein |
| Revised (this work) | YbhB/YbcL family Raf kinase inhibitor-like protein. Pfam: PBP (PF01161.26). |
| Functional category (TubercuList) | cell wall and cell processes |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 2 publications
2 TB publications mention this gene. 2 publication(s) discuss this gene (2 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| Proteomics of Culture Filtrate of Prevalent Mycobacterium tuberculosis Strains: 2D-PAGE Map and MALDI-TOF/MS Analysis. doi:10.1177/2472555217717639 | 2017 |
| Specific interaction between Mycobacterium tuberculosis lipoprotein-derived peptides and target cells inhibits mycobacterial entry in vitro. doi:10.1111/cbdd.12365 | 2014 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Intrinsic disorder (sequence + structure) partially disordered
| Predicted disorder | 40% of residues (metapredict) · mean AlphaFold pLDDT 87.6 |
|---|---|
| Disordered regions | 2 IDR(s), longest 55 aa [0-55, 119-144] |
carries a substantial disordered region (80/201 residues); disorder is a property, not a function
A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).
CRISPRi vulnerability
Vulnerability index 1.03 (95% CI -0.44 to 3.17). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb1946c
· 100.0% identity |
|---|---|
| M. orygis |
RJtmp_001983
· 100.0% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WFN3
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Putative lipoprotein LppC |
| Curated function | Probably involved in bacterial recognition and uptake by its host (human). |
UniProt still lists this protein as Putative lipoprotein LppC; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| Preferred name | lppC |
| eggNOG description | Phosphatidylethanolamine-binding protein |
| Orthologous group | COG1881 |
| KEGG orthology |
K06910
|
| Gene Ontology (7) |
GO:0005575, GO:0005576, GO:0005618, GO:0005623, GO:0030312, GO:0044464, GO:0071944
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.566 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 6 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| M. canettii dN/dS (deep-divergence selection) |
inf (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 38/53 (72%) · mean identity 66.8%
· 4/4 closest MTBAP relatives conserved across the genus (present in 38/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 6/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 33.7% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 9 in the ORF — 0 in the essential state, 0 growth-defect, 9 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 49.2222222222. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Read with some caution: only 9 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 9 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 12 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 186.0 ppm · rank 880/3519 (75.0th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Predicted localisation (DeepTMHMM + lipobox) lipoprotein
| Prediction | predicted lipoprotein (lipobox + signal peptide) |
|---|---|
| DeepTMHMM class | SP |
| Lipobox | signal-peptidase-II lipobox; lipidated Cys near position 24 |
Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.
Physico-chemical properties (computed, ProtParam)
| Length | 201 aa |
|---|---|
| Molecular weight | 19.8 kDa |
| Theoretical pI | 5.76 |
| GRAVY | 0.115 (hydrophobic) |
| Aliphatic index | 76.4 |
| Aromaticity | 0.06 |
| Instability index | 36.8 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
PBP | PF01161.26 | 1.9e-31 | 69–199 | Phosphatidylethanolamine-binding protein |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 87.6
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
3n08-assembly1_B |
1.00 | 0.84 | 4.2e-13 sig | 3n08-assembly1_B Crystal Structure of a Putative PhosphatidylEthanolamine-Binding Protein (PEBP) Homolog CT736 from Chlamydia trachomatis D/UW-3/CX |
1fux-assembly1_B |
1.00 | 0.82 | 1.8e-10 sig | 1fux-assembly1_B CRYSTAL STRUCTURE OF E.COLI YBCL, A NEW MEMBER OF THE MAMMALIAN PEBP FAMILY |
4beg-assembly1_A |
1.00 | 0.75 | 2.8e-11 sig | 4beg-assembly1_A Structure of Rv2140c, a phosphatidyl-ethanolamine binding protein from Mycobacterium tuberculosis in complex with sulphate |
Foldseek search of the AlphaFold DB model (mean pLDDT 87.6, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | Rv1910c (- strand, 82 bp gap) |
|---|---|
| Downstream (3' on genome) | fadB5 (- strand, 99 bp gap) |
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0708 rplP exp |
50S ribosomal protein L16 | 866 | 861 | experimental:784 |
Rv0704 rplB exp |
50S ribosomal protein L2 | 840 | 834 | experimental:779 |
Rv2890c rpsB exp |
30S ribosomal protein S2 | 832 | 832 | experimental:783 |
Rv3443c rplM exp |
50S ribosomal protein L13 | 828 | 822 | experimental:783 |
Rv0721 rpsE exp |
30S ribosomal protein S5 | 818 | 819 | experimental:783 |
Rv2785c rpsO exp |
30S ribosomal protein S15 | 818 | 818 | experimental:783 |
Rv3461c rpmJ exp |
50S ribosomal protein L36 | 823 | 817 | experimental:785 |
Rv0979A rpmF exp |
50S ribosomal protein L32 | 815 | 816 | experimental:786 |
Rv2441c rpmA exp |
50S ribosomal protein L27 | 823 | 815 | experimental:787 |
Rv2904c rplS exp |
50S ribosomal protein L19 | 820 | 809 | experimental:787 |
Rv2909c rpsP exp |
30S ribosomal protein S16 | 808 | 806 | experimental:785 |
Rv3442c rpsI exp |
30S ribosomal protein S9 | 805 | 806 | experimental:785 |
Rv3456c rplQ exp |
50S ribosomal protein L17 | 811 | 805 | experimental:785 |
Rv0723 rplO exp |
50S ribosomal protein L15 | 804 | 804 | experimental:787 |
Rv0701 rplC exp |
50S ribosomal protein L3 | 802 | 803 | experimental:785 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: lipoprotein LppC
- MTBC0 PGAP product: YbhB/YbcL family Raf kinase inhibitor-like protein
- Pfam (hmmscan --cut_ga): PBP PF01161.26 (E=2e-31)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216427.1)
- Domains: Pfam-A via hmmscan --cut_ga — PBP (PF01161.26)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1881 - Curated reference: UniProt P9WFN3 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 87.6)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 105 functional partner(s)
- Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide; (myco)bacterial lipobox (Sutcliffe & Harrington 2004, doi:10.1099/mic.0.26804-0)
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002026|Rv1911c|lppC MTSTLHRTPLATAGLALVVALGGCGGGGGDSRETPPYVPKATTVDATTPAPAAEPLTIASPMFADGAPIPVQFSCKGANVAPPLTWSSPAGAAELALVVDDPDAVGGLYVHWIVTGIAPGSGSTADGQTPAGGHSVPNSGGRQGYFGPCPPAGTGTHHYRFTLYHLPVALQLPPGATGVQAAQAIAQAASGQARLVGTFEG
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for lppC? Email the maintainer — the message is pre-filled with this gene's details.