grpE Resolved · high auto-curated

H37Rv Rv0351 · MTBC0 mtbc0_000372 · 235 aa · 425032–425739 (+) · RefSeq NP_214865.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)stress response protein GrpE
MTBC0 PGAP re-annotationnucleotide exchange factor GrpE
Revised (this work)Nucleotide exchange factor GrpE. Pfam: GrpE (PF01025.25).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WMT5 SwissProt · reviewed · Evidence at protein level
UniProt nameProtein GrpE
Curated functionParticipates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins, in association with DnaK and GrpE. It is the nucleotide exchange factor for DnaK and may function as a thermosensor. Unfolded proteins bind initially to DnaJ; upon interaction with the DnaJ-bound protein, DnaK hydrolyzes its bound ATP, resulting in the formation of a stable complex. GrpE releases ADP from DnaK; ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP-dependent interactions between Dn.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category O Post-translational modification, protein turnover, chaperones
Preferred namegrpE
eggNOG descriptionParticipates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins, in association with DnaK and GrpE. It is the nucleotide exchange factor for DnaK and may function as a thermosensor. Unfolded proteins bind initially to DnaJ
Orthologous groupCOG0576
KEGG orthology K03687
Gene Ontology (41) GO:0000166, GO:0000774, GO:0003674, GO:0005488, GO:0005515, GO:0005575, GO:0005618, GO:0005623, GO:0006950, GO:0007154, GO:0008150, GO:0009267 +29 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.672 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
GrpEPF01025.25 7.4e-2849–187 GrpE

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: dnaK (chaperone protein DnaK), high confidence from genomic context alone (score 999 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0350 dnaK chaperone protein DnaK 999 999 ctx neighborhood:882 coexpression:964 experimental:773 textmining:939
Rv0352 dnaJ1 chaperone protein DnaJ 999 999 ctx neighborhood:829 coexpression:984 experimental:439 textmining:948
Rv0353 hspR heat shock protein transcriptional repressor HspR 995 975 ctx neighborhood:829 coexpression:857 textmining:829
Rv0384c clpB chaperone protein ClpB 996 957 coexpression:948 textmining:933
Rv0440 groEL2 molecular chaperone GroEL 991 948 coexpression:834 experimental:437 database:455 textmining:851
Rv3446c hyp hypothetical protein 961 947 coexpression:702 experimental:773
Rv0312 hyp hypothetical protein 961 947 coexpression:704 experimental:773
Rv2264c hyp hypothetical protein 961 947 coexpression:703 experimental:773
Rv3417c groEL1 chaperonin GroEL 981 929 coexpression:747 experimental:437 database:455 textmining:753
Rv3418c groES chaperonin GroES 984 913 coexpression:893 textmining:828
Rv2373c dnaJ2 chaperone protein DnaJ 969 902 coexpression:748 experimental:439 textmining:707
Rv2374c hrcA heat-inducible transcription repressor HrcA 963 869 coexpression:858 textmining:735
Rv3596c clpC1 ATP-dependent protease ATP-binding subunit ClpC 908 768 coexpression:718 textmining:620
Rv2667 clpC2 ATP-dependent protease ATP-binding subunit ClpC 830 761 coexpression:709
Rv2299c htpG chaperone protein HtpG 821 756 coexpression:718

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: stress response protein GrpE
  • MTBC0 PGAP product: nucleotide exchange factor GrpE
  • Pfam (hmmscan --cut_ga): GrpE PF01025.25 (E=7e-28)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214865.1)
  • Domains: Pfam-A via hmmscan --cut_ga — GrpE (PF01025.25)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0576
  • Curated reference: UniProt P9WMT5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 113 functional partner(s); context anchor dnaK
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000372|Rv0351|grpE
MTDGNQKPDGNSGEQVTVTDKRRIDPETGEVRHVPPGDMPGGTAAADAAHTEDKVAELTADLQRVQADFANYRKRALRDQQAAADRAKASVVSQLLGVLDDLERARKHGDLESGPLKSVADKLDSALTGLGLVAFGAEGEDFDPVLHEAVQHEGDGGQGSKPVIGTVMRQGYQLGEQVLRHALVGVVDTVVVDAAELESVDDGTAVADTAENDQADQGNSADTSGEQAESEPSGS