fdxD Resolved · high auto-curated

H37Rv Rv3503c · MTBC0 mtbc0_003718 · 63 aa · 3946647–3946838 (-) · RefSeq NP_218020.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ferredoxin FdxD
MTBC0 PGAP re-annotationferredoxin
Revised (this work)Ferredoxin. Pfam: Fer4_15 (PF13459.12), Fer4_13 (PF13370.12).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6X7H4 TrEMBL · unreviewed · Evidence at protein level
UniProt nameFerredoxin
Curated functionFerredoxins are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
Preferred namefdxD
eggNOG descriptionferredoxin
Orthologous groupCOG1141
KEGG orthology K05337

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.158 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Fer4_15PF13459.12 5.1e-143–59 4Fe-4S single cluster domain
Fer4_13PF13370.12 1.2e-125–59 4Fe-4S single cluster domain of Ferredoxin I

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3502c (3-oxoacyl-ACP reductase), high confidence from genomic context alone (score 726 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3502c 3-oxoacyl-ACP reductase 726 726 ctx neighborhood:717
Rv0310c hyp hypothetical protein 545 545 ctx cooccurence:545
Rv3504 fadE26 acyl-CoA dehydrogenase FadE26 515 515 ctx neighborhood:500
Rv3687c rsfB anti-anti-sigma factor RsfB 489 490 ctx cooccurence:487
Rv0311 hyp hypothetical protein 481 482 ctx cooccurence:459
Rv0926c hyp hypothetical protein 480 481 ctx cooccurence:479
Rv3505 fadE27 acyl-CoA dehydrogenase FadE27 464 464 ctx neighborhood:457
Rv0763c ferredoxin 886 443 ctx cooccurence:439 textmining:805
Rv0762c hyp hypothetical protein 434 434 ctx cooccurence:408
Rv2600 integral membrane protein 419 420 ctx cooccurence:418
Rv3501c yrbE4A integral membrane protein 413 413 ctx neighborhood:410
Rv0764c cyp51 lanosterol 14-alpha demethylase 675 357 textmining:516
Rv1786 ferredoxin 543 300
Rv3059 cyp136 cytochrome P450 Cyp136 501 204 textmining:400
Rv2266 cyp124 cytochrome P450 Cyp124 594 199 textmining:515

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ferredoxin FdxD
  • MTBC0 PGAP product: ferredoxin
  • Pfam (hmmscan --cut_ga): Fer4_15 PF13459.12 (E=5e-14), Fer4_13 PF13370.12 (E=1e-12)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218020.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Fer4_15 (PF13459.12), Fer4_13 (PF13370.12)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1141
  • Curated reference: UniProt I6X7H4 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 26 functional partner(s); context anchor Rv3502c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003718|Rv3503c|fdxD
MRVIVDRDRCEGNAVCLGIAPDIFDLDDEDYAVVKTDPIPVDQEDLAEQAIAECPRAALSRGE