icd2 Resolved · high auto-curated
H37Rv Rv0066c · MTBC0 mtbc0_000073 ·
745 aa ·
72419–74656 MTBC0
(-) ·
RefSeq NP_214580.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | isocitrate dehydrogenase |
|---|---|
| MTBC0 PGAP re-annotation | NADP-dependent isocitrate dehydrogenase |
| Revised (this work) | NADP-dependent isocitrate dehydrogenase. Pfam: IDH (PF03971.20). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 8 publications
8 TB publications mention this gene. 8 publication(s) discuss this gene (8 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| Identification of Mycobacterium tuberculosis intracellular survival-related virulence factors via CRISPR-based eukaryotic-like secretory protein mutant library screen. doi:10.1128/spectrum.00767-25 | 2025 |
| Understanding the Genetic Diversity of Mycobacterium africanum Using Phylogenetics and Population Genomics Approaches. doi:10.3389/fgene.2022.800083 | 2022 |
| Proteomics of Culture Filtrate of Prevalent Mycobacterium tuberculosis Strains: 2D-PAGE Map and MALDI-TOF/MS Analysis. doi:10.1177/2472555217717639 | 2017 |
| Global effects of inactivation of the pyruvate kinase gene in the Mycobacterium tuberculosis complex. doi:10.1128/JB.00619-09 | 2009 |
| Determination of phosphorylation sites for NADP-specific isocitrate dehydrogenase from mycobacterium tuberculosis. doi:10.1080/07391102.2009.10507286 | 2009 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index 0.40 (95% CI -2.33 to 4.05). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in the KREBS cycle [catalytic activity: isocitrate + NADP+ = 2-oxoglutarate + CO(2) + NADPH]. |
|---|---|
| Mycobrowser EC |
1.1.1.42
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb0067c
· 99.9% identity |
|---|---|
| M. leprae |
ML2672c
· 85.4% identity |
| M. marinum |
MMAR_0158
· 89.4% identity |
| M. smegmatis |
MSMEG_1654
· 82.0% identity |
| M. orygis |
RJtmp_000073
· 99.9% identity |
| M. abscessus |
MAB_3686c
· 81.2% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
O53611
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Isocitrate dehydrogenase [NADP] 2 |
| EC (curated) |
EC 1.1.1.42
|
| Curated function | Catalyzes the oxidative decarboxylation of isocitrate to 2-oxoglutarate and carbon dioxide with the concomitant reduction of NADP(+). Cannot use NAD(+). |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
C Energy production and conversion
|
|---|---|
| Preferred name | icd |
| eggNOG description | Isocitrate dehydrogenase |
| Orthologous group | COG2838 |
| EC number |
EC 1.1.1.42
|
| KEGG orthology |
K00031
|
| KEGG pathways |
map00020, map00480, map00720, map01100, map01110, map01120, map01130, map01200, map01210, map01230, map04146
|
| KEGG modules |
M00009, M00010, M00173, M00740
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.302 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 11 synonymous, 11 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| M. canettii dN/dS (deep-divergence selection) |
0.121 (low power)
· 7 consensus substitution(s) low power (7 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 50/53 (94%) · mean identity 85.6%
· 4/4 closest MTBAP relatives conserved across the genus (present in 50/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 9/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 68.5% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 38 in the ORF — 0 in the essential state, 0 growth-defect, 38 non-essential, 0 growth-advantage. Saturation 0.868, mean read count 44.7575757576. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain
This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.
| Hypomorph strain | Rv0066c-TetOn 10.2 (TetON promoter 10) |
|---|---|
| Baseline knockdown fitness | 4.055 median doublings (across 6 screen pool(s)) — fewer doublings = stronger growth defect on knockdown |
| Used in target deconvolution | yes (informs phenotypic-cluster / MOA assignment) |
Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness in mouse infection (in vivo) | +5.55 | 0.0 | disruption advantageous |
| Differential genetic requirements of clinical Mtb strain (ID=630) from Euro-American lineage (compared to H37Rv control) (strain background) | +4.63 | 0.0 | required |
| Differential genetic requirements of clinical Mtb strain (ID=667) from Indo-Oceanic lineage (compared to H37Rv control) (strain background) | +4.38 | 0.0 | required |
| Differential genetic requirements of clinical Mtb strain (ID=621) from East Asian lineage (compared to H37Rv control) (strain background) | +4.28 | 0.0 | required |
| Differential genetic requirements of clinical Mtb strain (ID=632) from East Asian lineage (compared to H37Rv control) (strain background) | +4.27 | 0.0 | required |
| Differential genetic requirements of clinical Mtb strain (ID=663) from Euro-American lineage (compared to H37Rv control) (strain background) | +3.96 | 0.0 | required |
| Differential genetic requirements of clinical Mtb strain (ID=662) from East Asian lineage (compared to H37Rv control) (strain background) | +3.78 | 0.0 | required |
| Differential genetic requirements of clinical Mtb strain (ID=641) from Indo-Oceanic lineage (compared to H37Rv control) (strain background) | +3.62 | 0.0 | required |
| Differential genetic requirements of clinical Mtb strain (ID=631) from East Asian lineage (compared to H37Rv control) (strain background) | +3.39 | 0.0 | required |
| fitness in mouse infection (in vivo) | -3.05 | 0.042 | required |
| fitness in mouse infection (in vivo) | -3.04 | 0.041 | required |
| fitness in mouse infection (in vivo) | -3.04 | 0.049 | required |
Conditional fitness of transposon-disruption mutants across 21 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 16 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 2286.0 ppm · rank 60/3519 (98.3th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 745 aa |
|---|---|
| Molecular weight | 82.5 kDa |
| Theoretical pI | 5.24 |
| GRAVY | -0.289 (hydrophilic) |
| Aliphatic index | 85.8 |
| Aromaticity | 0.071 |
| Instability index | 37.6 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
IDH | PF03971.20 | 0.0e+00 | 7–740 | Monomeric isocitrate dehydrogenase |
Experimental structures (Protein Data Bank) 1 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
5kvu |
X-ray diffraction | 2.66 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (1 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 96.0
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
5kvu-assembly3_C |
1.00 | 0.93 | 0.0e+00 sig | 5kvu-assembly3_C Crystal structure of isocitrate dehydrogenase-2 in complex with NADP(+) from Mycobacterium tuberculosis |
5kvu-assembly1_A |
1.00 | 0.93 | 0.0e+00 sig | 5kvu-assembly1_A Crystal structure of isocitrate dehydrogenase-2 in complex with NADP(+) from Mycobacterium tuberculosis |
5kvu-assembly2_B |
1.00 | 0.93 | 0.0e+00 sig | 5kvu-assembly2_B Crystal structure of isocitrate dehydrogenase-2 in complex with NADP(+) from Mycobacterium tuberculosis |
5kvu-assembly4_D |
1.00 | 0.92 | 0.0e+00 sig | 5kvu-assembly4_D Crystal structure of isocitrate dehydrogenase-2 in complex with NADP(+) from Mycobacterium tuberculosis |
4zda-assembly1_B |
1.00 | 0.98 | 0.0e+00 sig | 4zda-assembly1_B Crystal structure of isocitrate dehydrogenase in complex with isocitrate and Mn from M. smegmatis |
Foldseek search of the AlphaFold DB model (mean pLDDT 96.0, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | vapC1 (+ strand, 51 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv0067c (- strand, 117 bp gap) |
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2455c korA exp |
2-oxoglutarate oxidoreductase subunit KorA | 987 | 975 | coexpression:668 database:900 textmining:516 |
Rv2454c korB exp |
2-oxoglutarate oxidoreductase subunit KorB | 946 | 944 | coexpression:417 database:900 |
Rv1475c acn exp |
iron-regulated aconitate hydratase | 965 | 919 | database:900 textmining:591 |
Rv3339c icd1 exp |
isocitrate dehydrogenase | 938 | 908 | database:900 |
Rv1240 mdh |
malate dehydrogenase | 934 | 870 | coexpression:859 textmining:517 |
Rv0777 purB exp |
adenylosuccinate lyase PurB | 839 | 839 | database:800 |
Rv2476c gdh exp |
NAD-dependent glutamate dehydrogenase | 827 | 812 | database:800 |
Rv1731 gabD2 exp |
succinate-semialdehyde dehydrogenase | 810 | 810 | database:800 |
Rv0234c gabD1 exp |
succinate-semialdehyde dehydrogenase | 810 | 810 | database:800 |
Rv1595 nadB exp |
L-aspartate oxidase | 809 | 809 | database:800 |
Rv0337c aspC exp |
aspartate aminotransferase | 806 | 807 | database:800 |
Rv3858c gltD exp |
glutamate synthase small subunit | 812 | 806 | database:800 |
Rv1659 argH exp |
argininosuccinate lyase | 815 | 804 | database:800 |
Rv3859c gltB exp |
glutamate synthase large subunit | 921 | 801 | database:800 textmining:622 |
Rv2280 |
Rv2280, (MTCY339.30c), len: 459 aa. Probable dehydrogenase. Similar to D-lactate dehydrogenase (cytochrome) precursor e.g. G1061264 (587 aa) | 745 | 738 | coexpression:738 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: isocitrate dehydrogenase
- MTBC0 PGAP product: NADP-dependent isocitrate dehydrogenase
- Pfam (hmmscan --cut_ga): IDH PF03971.20 (E=0e+00)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214580.1)
- Domains: Pfam-A via hmmscan --cut_ga — IDH (PF03971.20)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2838 - Curated reference: UniProt O53611 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 96.0)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 38 functional partner(s)
- Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000073|Rv0066c|icd2 MSAEQPTIIYTLTDEAPLLATYAFLPIVRAFAEPAGIKIEASDISVAARILAEFPDYLTEEQRVPDNLAELGRLTQLPDTNIIKLPNISASVPQLVAAIKELQDKGYAVPDYPADPKTDQEKAIKERYARCLGSAVNPVLRQGNSDRRAPKAVKEYARKHPHSMGEWSMASRTHVAHMRHGDFYAGEKSMTLDRARNVRMELLAKSGKTIVLKPEVPLDDGDVIDSMFMSKKALCDFYEEQMQDAFETGVMFSLHVKATMMKVSHPIVFGHAVRIFYKDAFAKHQELFDDLGVNVNNGLSDLYSKIESLPASQRDEIIEDLHRCHEHRPELAMVDSARGISNFHSPSDVIVDASMPAMIRAGGKMYGADGKLKDTKAVNPESTFSRIYQEIINFCKTNGQFDPTTMGTVPNVGLMAQQAEEYGSHDKTFEIPEDGVANIVDVATGEVLLTENVEAGDIWRMCIVKDAPIRDWVKLAVTRARISGMPVLFWLDPYRPHENELIKKVKTYLKDHDTEGLDIQIMSQVRSMRYTCERLVRGLDTIAATGNILRDYLTDLFPILELGTSAKMLSVVPLMAGGGMYETGAGGSAPKHVKQLVEENHLRWDSLGEFLALGAGFEDIGIKTGNERAKLLGKTLDAAIGKLLDNDKSPSRKTGELDNRGSQFYLAMYWAQELAAQTDDQQLAEHFASLADVLTKNEDVIVRELTEVQGEPVDIGGYYAPDSDMTTAVMRPSKTFNAALEAVQG
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for icd2? Email the maintainer — the message is pre-filled with this gene's details.