treZ Resolved · high auto-curated

H37Rv Rv1562c · MTBC0 - · 580 aa · 1765400–1767142 (-) · RefSeq YP_177819.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)malto-oligosyltrehalose trehalohydrolase
MTBC0 PGAP re-annotation
Revised (this work)Malto-oligosyltrehalose trehalohydrolase. Pfam: Alpha-amylase (PF00128.32), DUF3459 (PF11941.15).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WQ23 SwissProt · reviewed · Evidence at protein level
UniProt nameMalto-oligosyltrehalose trehalohydrolase
EC (curated) EC 3.2.1.141
Curated functionIs involved in the biosynthesis of trehalose but not in that of capsular glucan and glycogen.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category G Carbohydrate transport and metabolism
Preferred nametreZ
eggNOG description4-alpha-D-((1- 4)-alpha-D-glucano)trehalose trehalohydrolase
Orthologous groupCOG0296
EC number EC 3.2.1.141
KEGG orthology K01236
KEGG pathways map00500, map01100, map01110
KEGG modules M00565
CAZy family CBM48, GH13
Gene Ontology (50) GO:0000272, GO:0003674, GO:0003824, GO:0004553, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005975, GO:0005976, GO:0005984 +38 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.33 · purifying
Polymorphic sites (≥ 0.1% of strains) 8 synonymous, 8 missense, 0 nonsense, 2 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 16.16% of strains (23468) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Alpha-amylasePF00128.32 4.2e-12109–193 Alpha amylase, catalytic domain
DUF3459PF11941.15 9.4e-09508–572 Domain of unknown function (DUF3459)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: treY (maltooligosyl trehalose synthase), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1563c treY maltooligosyl trehalose synthase 999 1000 ctx neighborhood:882 fusion:635 coexpression:889 database:900 textmining:747
Rv1564c treX maltooligosyl trehalose synthase 991 990 ctx neighborhood:882 coexpression:741 database:500
Rv2006 otsB1 trehalose-6-phosphate phosphatase OtsB 992 968 coexpression:496 database:900 textmining:773
Rv3372 otsB2 trehalose 6-phosphate phosphatase 994 964 coexpression:407 database:900 textmining:865
Rv0126 treS trehalose synthase/amylase TreS 988 948 database:900 textmining:796
Rv2402 trehalase 980 923 database:900 textmining:755
Rv3401 glycosyl hydrolase 925 923 database:900
Rv1212c glgA capsular glucan synthase 987 834 coexpression:407 database:572 textmining:925
Rv1565c acyltransferase 829 829 ctx neighborhood:827
Rv1327c glgE alpha-1,4-glucan:maltose-1-phosphate maltosyltransferase 990 814 ctx cooccurence:728 textmining:949
Rv0127 mak maltokinase 976 811 ctx cooccurence:706 textmining:879
Rv1328 glgP glycogen phosphorylase 930 802 coexpression:729 textmining:663
Rv1213 glgC glucose-1-phosphate adenylyltransferase 980 798 coexpression:732 textmining:909
Rv3032 glycogen synthase 929 782 coexpression:411 database:572 textmining:688
Rv2610c pimA alpha-(1-2)-phosphatidylinositol mannosyltransferase 801 782 coexpression:411 database:572

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): malto-oligosyltrehalose trehalohydrolase
  • Pfam (hmmscan --cut_ga): Alpha-amylase PF00128.32 (E=4e-12), DUF3459 PF11941.15 (E=9e-09)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177819.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Alpha-amylase (PF00128.32), DUF3459 (PF11941.15)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0296
  • Curated reference: UniProt P9WQ23 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 45 functional partner(s); context anchor treY
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1562c|treZ
MPEFRVWAPKPALVRLDVNGAVHAMTRSADGWWHTTVAAPADARYGYLLDDDPTVLPDPRSARQPDGVHARSQRWEPPGQFGAARTDTGWPGRSVEGAVIYELHIGTFTTAGTFDAAIEKLDYLVDLGIDFVELMPVNSFAGTRGWGYDGVLWYSVHEPYGGPDGLVRFIDACHARRLGVLIDAVFNHLGPSGNYLPRFGPYLSSASNPWGDGINIAGADSDEVRHYIIDCALRWMRDFHADGLRLDAVHALVDTTAVHVLEELANATRWLSGQLGRPLSLIAETDRNDPRLITRPSHGGYGITAQWNDDIHHAIHTAVSGERQGYYADFGSLATLAYTLRNGYFHAGTYSSFRRRRHGRALDTSAIPATRLLAYTCTHDQVGNRALGDRPSQYLTGGQLAIKAALTLGSPYTAMLFMGEEWGASSPFQFFCSHPEPELAHSTVAGRKEEFAEHGWAADDIPDPQDPQTFQRCKLNWAEAGSGEHARLHRFYRDLIALRHNEADLADPWLDHLMVDYDEQQRWVVMRRGQLMIACNLGAEPTCVPVSGELVLAWESPIIGDNSTELAAYSLAILRAAEPA