lprA Resolved · high auto-curated

H37Rv Rv1270c · MTBC0 mtbc0_001360 · 244 aa · 1427997–1428731 (-) · RefSeq NP_215786.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)lipoprotein LprA
MTBC0 PGAP re-annotationTLR2 agonist LprA
Revised (this work)TLR2 agonist LprA. Pfam: LppX_LprAFG (PF07161.20).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WK55 SwissProt · reviewed · Evidence at protein level
UniProt nameLipoprotein LprA
Curated functionConstitutes a host TLR2 agonist (toll-like receptor), shown experimentally for human and mouse. In host cells full-length (acylated) protein acts as a TLR2 agonist, inducing human and murine macrophages to produce cytokines, inducing murine dendritic cell maturation and cytokine production and inhibiting antibody processing in murine macrophages. Binds diacylated phosphatidyl-myo-inositol mannosides (PIMs). Does not induce murine macrophage apoptosis or necrosis. Non-acylated protein does not act as a TLR2 agonist. Requires only host TLR2 as receptors to elicit host response in mouse, although.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category M Cell wall / membrane / envelope biogenesis
Preferred namelprA
eggNOG descriptionLppX_LprAFG lipoprotein
Orthologous group2DQVM
KEGG orthology K14954, K14955
KEGG pathways map05152
Gene Ontology (52) GO:0003674, GO:0005102, GO:0005488, GO:0005515, GO:0005575, GO:0005576, GO:0005618, GO:0005623, GO:0005886, GO:0008150, GO:0009605, GO:0009607 +40 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.867 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
LppX_LprAFGPF07161.20 1.4e-7045–239 LppX_LprAFG lipoprotein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: papA5 (phthiocerol/phthiodiolone dimycocerosyl transferase), medium confidence from genomic context alone (score 661 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0493c hyp hypothetical protein 680 681 ctx cooccurence:676
Rv1269c hyp hypothetical protein 668 669 ctx neighborhood:669
Rv2939 papA5 phthiocerol/phthiodiolone dimycocerosyl transferase 660 661 ctx cooccurence:660
Rv2365c hyp hypothetical protein 632 632 ctx cooccurence:632
Rv3909 hyp hypothetical protein 566 566 ctx cooccurence:565
Rv0538 membrane protein 556 557 ctx cooccurence:554
Rv2608 PPE42 PPE family protein PPE42 545 546 ctx cooccurence:540
Rv3413c rsdA anti-sigma-D factor RsdA 529 529 ctx cooccurence:529
Rv3415c hyp hypothetical protein 525 525 ctx cooccurence:525
Rv1111c hyp hypothetical protein 502 502 ctx cooccurence:495
Rv2695 hyp hypothetical protein 479 480 ctx cooccurence:473
Rv3788 hyp hypothetical protein 477 478 ctx cooccurence:454
Rv0676c mmpL5 transmembrane transport protein MmpL5 475 476 ctx cooccurence:475
Rv1271c hyp hypothetical protein 469 468 ctx neighborhood:468
Rv1963c mce3R transcriptional repressor Mce3R 468 468 ctx cooccurence:465

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: lipoprotein LprA
  • MTBC0 PGAP product: TLR2 agonist LprA
  • Pfam (hmmscan --cut_ga): LppX_LprAFG PF07161.20 (E=1e-70)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215786.1)
  • Domains: Pfam-A via hmmscan --cut_ga — LppX_LprAFG (PF07161.20)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2DQVM
  • Curated reference: UniProt P9WK55 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 72 functional partner(s); context anchor papA5
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001360|Rv1270c|lprA
MKHPPCSVVAAATAILAVVLAIGGCSTEGDAGKASDTAATASNGDAAMLLKQATDAMRKVTGMHVRLAVTGDVPNLRVTKLEGDISNTPQTVATGSATLLVGNKSEDAKFVYVDGHLYSDLGQPGTYTDFGNGASIYNVSVLLDPNKGLANLLANLKDASVAGSQQADGVATTKITGNSSADDIATLAGSRLTSEDVKTVPTTVWIASDGSSHLVQIQIAPTKDTSVTLTMSDWGKQVTATKPV