Rv1271c Family assigned · low
H37Rv Rv1271c · MTBC0 mtbc0_001361 ·
113 aa · 1428944–1429285 (-) ·
RefSeq NP_215787.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | DUF732 domain-containing protein |
| Revised (this work) | Secreted protein recognised as an antigen (antibody responses during active TB). Pfam DUF732 (a mycobacterial domain of unknown function). Molecular function unfixed. |
Curated reference (UniProt)
| UniProt |
P9WM43
SwissProt · reviewed
· Inferred from homology
|
|---|---|
| UniProt name | Uncharacterized protein Rv1271c |
UniProt still lists this protein as Uncharacterized protein Rv1271c; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Protein of unknown function (DUF732) |
| Orthologous group | 2BN0A |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.0 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 0 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DUF732 | PF05305.20 | 2.8e-18 | 37–107 | Protein of unknown function (DUF732) |
Structural neighbours (Foldseek on the ESMFold model, exploratory)
ESMFold model confidence: mean pLDDT 71.1 (confident). A confident model makes the fold comparison meaningful.
Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.
| Target | Prob | TM | E-value | Description |
|---|---|---|---|---|
2gtg-assembly1_A |
0.09 | 0.43 | 4.5e+00 | 2gtg-assembly1_A Crystal Structure of Human Saposin C |
4rue-assembly1_B |
0.06 | 0.28 | 5.3e+00 | 4rue-assembly1_B Human K2P4.1 (TRAAK) potassium channel, G124I mutant |
6w8f-assembly1_B |
0.05 | 0.28 | 7.1e+00 | 6w8f-assembly1_B K2P2.1 (TREK-1):ML335 complex, 0 mM K+ |
6w84-assembly1_B |
0.03 | 0.27 | 8.9e+00 | 6w84-assembly1_B K2P2.1 (TREK-1), 200 mM K+ |
7sii-assembly1_C |
0.02 | 0.18 | 5.0e+00 | 7sii-assembly1_C Human STING bound to both cGAMP and 1-[(2-chloro-6-fluorophenyl)methyl]-3,3-dimethyl-2-oxo-N-[(2,4,6-trifluorophenyl)methyl]-2,3-dihydro-1H-indole-6-carboxamide (Compound 53) |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv1272c (drug ABC transporter ATP-binding protein), medium confidence from genomic context alone (score 572 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1272c |
drug ABC transporter ATP-binding protein | 572 | 572 ctx | neighborhood:572 |
Rv1273c |
drug ABC transporter ATP-binding protein | 534 | 534 ctx | neighborhood:534 |
Rv1270c lprA |
lipoprotein LprA | 469 | 468 ctx | neighborhood:468 |
Rv0603 hyp |
hypothetical protein | 870 | 41 | textmining:870 |
Rv2253 hyp |
hypothetical protein | 870 | 41 | textmining:870 |
Rv0203 hyp |
hypothetical protein | 696 | 41 | textmining:696 |
Rv0934 pstS1 |
phosphate ABC transporter substrate-binding lipoprotein PstS | 511 | 41 | textmining:511 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Novel secreted antigen; antibody response in active TB (Ben Amor 2005, PMID 15683450)
- Pfam DUF732
- Curated from the literature crible (project 'Still unknown gene function', 2026-06-09)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215787.1)
- Domains: Pfam-A via hmmscan --cut_ga — DUF732 (PF05305.20)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2BN0A - Curated reference: UniProt P9WM43 (SwissProt, reviewed; Inferred from homology)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Model confidence: ESMFold per-residue pLDDT (mean 71.1, confident)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
7 functional partner(s); context anchor
Rv1272c - Primary literature: Ben Amor Y, Shashkina E, Johnson S, Bifani PJ, Kurepina N, Kreiswirth B, Bhattacharya S, Spencer J, Rendon A, Catanzaro A, Gennaro ML (2005). Immunological characterization of novel secreted antigens of Mycobacterium tuberculosis Scand J Immunol 61(2):139-46. doi:10.1111/j.0300-9475.2005.01557.x PMID:15683450
Ancestral MTBC0 protein sequence
>mtbc0_001361|Rv1271c| MLSPLSPRIIAAFTTAVGAAAIGLAVATAGTAGANTKDEAFIAQMESIGVTFSSPQVATQQAQLVCKKLASGETGTEIAEEVLSQTNLTTKQAAYFVVDATKAYCPQYASQLT