Rv1268c Family assigned · medium auto-curated
H37Rv Rv1268c · MTBC0 mtbc0_001358 ·
232 aa · 1426641–1427339 (-) ·
RefSeq NP_215784.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | C39 family peptidase |
| Revised (this work) | C39 family peptidase. Pfam: Peptidase_C39_2 (PF13529.14). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WM47
SwissProt · reviewed
· Inferred from homology
|
|---|---|
| UniProt name | Uncharacterized protein Rv1268c |
UniProt still lists this protein as Uncharacterized protein Rv1268c; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| Orthologous group | COG3271 |
|---|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.322 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Peptidase_C39_2 | PF13529.14 | 2.3e-09 | 110–224 | Peptidase_C39 like family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: embR (transcriptional regulator EmbR), medium confidence from genomic context alone (score 411 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1269c hyp |
hypothetical protein | 491 | 491 ctx | neighborhood:491 |
Rv1267c embR |
transcriptional regulator EmbR | 411 | 411 ctx | neighborhood:405 |
Rv1270c lprA |
lipoprotein LprA | 402 | 402 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: C39 family peptidase
- Pfam (hmmscan --cut_ga): Peptidase_C39_2 PF13529.14 (E=2e-09)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215784.1)
- Domains: Pfam-A via hmmscan --cut_ga — Peptidase_C39_2 (PF13529.14)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG3271 - Curated reference: UniProt P9WM47 (SwissProt, reviewed; Inferred from homology)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
3 functional partner(s); context anchor
embR - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001358|Rv1268c| MTTSKIATAFKTATFALAAGAVALGLASPADAAAGTMYGDPAAAAKYWRQQTYDDCVLMSAADVIGQVTGREPSERAIIKVAQSTPSVVHPGSIYTKPADAEHPNSGMGTSVADIPTLLAHYGVDAVITDEDHATATGVATGMAALEQYLGSGHAVIVSINAEMIWGQPVEETDSAGNPRSDHAVVVTGVDTENGIVHLNDSGTPTGRDEQIPMETFVEAWATSHDFMAVTT