hisE Resolved · high auto-curated
H37Rv Rv2122c · MTBC0 - ·
93 aa · 2380663–2380944 (-) ·
RefSeq YP_177860.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | phosphoribosyl-ATP pyrophosphatase |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Phosphoribosyl-ATP pyrophosphatase. Pfam: PRA-PH (PF01503.23), MazG (PF03819.23). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
P9WMM9
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Phosphoribosyl-ATP pyrophosphatase |
| EC (curated) |
EC 3.6.1.31
|
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
E Amino acid transport and metabolism
|
|---|---|
| Preferred name | hisE |
| eggNOG description | Phosphoribosyl-ATP |
| Orthologous group | COG0140 |
| EC number |
EC 3.6.1.31
|
| KEGG orthology |
K01523
|
| KEGG pathways |
map00340, map01100, map01110, map01230
|
| KEGG modules |
M00026
|
| Gene Ontology (25) |
GO:0000287, GO:0003674, GO:0005488, GO:0005575, GO:0005618, GO:0005623, GO:0008150, GO:0009605, GO:0009607, GO:0030312, GO:0040007, GO:0043167 +13 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.167 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
PRA-PH | PF01503.23 | 5.2e-10 | 12–93 | Phosphoribosyl-ATP pyrophosphohydrolase |
MazG | PF03819.23 | 3.2e-05 | 39–92 | MazG nucleotide pyrophosphohydrolase domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: hisG (ATP phosphoribosyltransferase), high confidence from genomic context alone (score 999 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2121c hisG |
ATP phosphoribosyltransferase | 999 | 999 ctx | neighborhood:882 cooccurence:713 coexpression:859 database:900 textmining:937 |
Rv1606 hisI |
phosphoribosyl-AMP cyclohydrolase | 992 | 990 | coexpression:857 database:900 |
Rv1605 hisF |
imidazole glycerol phosphate synthase subunit HisF | 965 | 891 | coexpression:857 textmining:694 |
Rv1599 hisD |
histidinol dehydrogenase | 965 | 890 | coexpression:852 textmining:704 |
Rv1602 hisH |
imidazole glycerol phosphate synthase subunit HisH | 943 | 889 | coexpression:857 textmining:517 |
Rv1603 hisA |
1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase | 963 | 886 | coexpression:857 textmining:693 |
Rv1601 hisB |
imidazole glycerol-phosphate dehydratase | 981 | 885 | coexpression:857 textmining:848 |
Rv1600 hisC1 |
histidinol-phosphate aminotransferase | 858 | 809 | coexpression:685 |
Rv3772 hisC2 |
histidinol-phosphate aminotransferase | 726 | 696 | coexpression:685 |
Rv2231c cobC |
aminotransferase | 726 | 696 | coexpression:685 |
Rv2120c |
integral membrane protein | 682 | 682 ctx | neighborhood:679 |
Rv0828c |
deaminase | 640 | 627 | coexpression:627 |
Rv3114 hyp |
hypothetical protein | 638 | 625 | coexpression:625 |
Rv3752c tadA |
cytidine/deoxycytidylate deaminase | 638 | 625 | coexpression:625 |
Rv3859c gltB |
glutamate synthase large subunit | 648 | 611 ctx | neighborhood:544 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): phosphoribosyl-ATP pyrophosphatase
- Pfam (hmmscan --cut_ga): PRA-PH PF01503.23 (E=5e-10), MazG PF03819.23 (E=3e-05)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177860.1)
- Domains: Pfam-A via hmmscan --cut_ga — PRA-PH (PF01503.23), MazG (PF03819.23)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0140 - Curated reference: UniProt P9WMM9 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
50 functional partner(s); context anchor
hisG - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv2122c|hisE MQQSLAVKTFEDLFAELGDRARTRPADSTTVAALDGGVHALGKKLLEEAGEVWLAAEHESNDALAEEISQLLYWTQVLMISRGLSLDDVYRKL