narI Family assigned · medium auto-curated

H37Rv Rv1164 · MTBC0 mtbc0_001253 · 246 aa · 1301847–1302587 (+) · RefSeq NP_215680.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)nitrate reductase subunit gamma
MTBC0 PGAP re-annotationrespiratory nitrate reductase subunit gamma
Revised (this work)Respiratory nitrate reductase subunit gamma. Pfam: Nitrate_red_gam (PF02665.20).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O06562 TrEMBL · unreviewed · Evidence at protein level
UniProt nameNitrate reductase-like protein NarX
Curated functionDoes not seem to have nitrate reductase activity.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
Preferred namenarI
eggNOG descriptionnitrate reductase, gamma subunit
Orthologous groupCOG2181
EC number EC 1.7.5.1
KEGG orthology K00370, K00374
KEGG pathways map00910, map01120, map02020
KEGG modules M00529, M00530, M00804

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.337 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Nitrate_red_gamPF02665.20 2.2e-869–228 Nitrate reductase gamma subunit

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: narH (nitrate reductase subunit beta), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1162 narH nitrate reductase subunit beta 999 1000 ctx neighborhood:804 cooccurence:774 coexpression:957 experimental:652 database:900 textmining:938
Rv1161 narG nitrate reductase subunit alpha 999 1000 ctx neighborhood:763 cooccurence:774 coexpression:797 experimental:773 database:900 textmining:939
Rv1163 narJ nitrate reductase subunit delta 999 999 ctx neighborhood:881 cooccurence:774 coexpression:957 textmining:965
Rv1736c narX nitrate reductase-like protein NarX 996 994 coexpression:728 experimental:773 database:900 textmining:424
Rv1737c narK2 nitrate/nitrite transporter 998 988 ctx cooccurence:766 coexpression:431 database:900 textmining:854
Rv0267 narU nitrite extrusion protein NarU 993 978 ctx cooccurence:613 coexpression:434 database:900 textmining:710
Rv2329c narK1 nitrate/nitrite transporter 991 978 ctx cooccurence:618 coexpression:435 database:900 textmining:607
Rv0261c narK3 nitrate/nitrite transporter 983 977 ctx cooccurence:588 coexpression:433 database:900
Rv0253 nirD nitrite reductase small subunit NirD 965 941 coexpression:418 database:900 textmining:430
Rv0252 nirB nitrite reductase large subunit NirB 954 924 database:900 textmining:424
Rv2781c oxidoreductase 903 904 database:900
Rv0021c hyp hypothetical protein 902 903 database:900
Rv1165 typA GTP-binding translation elongation factor 829 792 ctx neighborhood:761
Rv1166 lpqW monoacyl phosphatidylinositol tetramannoside-binding protein LpqW 767 767 ctx neighborhood:755
Rv2847c cysG multifunctional uroporphyrin-III C-methyltransferase/precorrin-2 oxidase/ferrochelatase 628 629 coexpression:512

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: nitrate reductase subunit gamma
  • MTBC0 PGAP product: respiratory nitrate reductase subunit gamma
  • Pfam (hmmscan --cut_ga): Nitrate_red_gam PF02665.20 (E=2e-86)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215680.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Nitrate_red_gam (PF02665.20)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2181
  • Curated reference: UniProt O06562 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 30 functional partner(s); context anchor narH
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001253|Rv1164|narI
MAVLDLVEIFWDAAPYVVVAIAVVGTWWRYRYDKFGWTTRSSQLYESRLLSIGSPMFHFGSLLVIMGHVMGLFIPDSWTRAFGMSDHLYHLQALLLGAPAGFATLLGIGLLIYRRRIQTPVWLATTRNDKLMYLVLVCAIVAGLACTLMGATHEGDMHDYRRSVSVWFRSIWMLAPRGDLMAQATLYYQVHVLIALALFALWPFTRLVHAFSAPIAYLFRPYIVYRSREVAAKHELIGSAPRRRGW