fdxC Family assigned · medium auto-curated

H37Rv Rv1177 · MTBC0 mtbc0_001266 · 108 aa · 1317446–1317772 (+) · RefSeq NP_215693.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ferredoxin FdxC
MTBC0 PGAP re-annotationferredoxin family protein
Revised (this work)Ferredoxin family protein. Pfam: Fer4 (PF00037.33).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O50433 TrEMBL · unreviewed · Evidence at protein level
UniProt nameFerredoxin
Curated functionFerredoxins are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
Preferred namefdxA
eggNOG descriptionferredoxin
Orthologous groupCOG1146
KEGG orthology K05524

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Fer4PF00037.33 2.1e-0834–55 4Fe-4S binding domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: dapC (aminotransferase), high confidence from genomic context alone (score 903 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1178 dapC aminotransferase 950 903 ctx neighborhood:833 fusion:405 textmining:510
Rv0824c desA1 acyl-ACP desaturase DesA 896 798 coexpression:798 textmining:511
Rv1094 desA2 acyl-ACP desaturase DesA 883 770 coexpression:770 textmining:516
Rv0823c dusB tRNA-dihydrouridine synthase 767 767 coexpression:767
Rv1176c hyp hypothetical protein 731 732 ctx neighborhood:731
Rv2455c korA 2-oxoglutarate oxidoreductase subunit KorA 805 726 coexpression:687
Rv0066c icd2 isocitrate dehydrogenase 714 695 coexpression:683
Rv1240 mdh malate dehydrogenase 709 692 coexpression:680
Rv1175c fadH NADPH dependent 2,4-dienoyl-CoA reductase FadH 793 681 ctx neighborhood:522
Rv3106 fprA NADPH-ferredoxin reductase FprA 869 486 textmining:756
Rv2454c korB 2-oxoglutarate oxidoreductase subunit KorB 487 437 coexpression:416
Rv0886 fprB ferredoxin/ferredoxin--NADP reductase 492 427
Rv3797 fadE35 acyl-CoA dehydrogenase FadE35 404 403 ctx neighborhood:403
Rv3858c gltD glutamate synthase small subunit 415 382
Rv3110 moaB1 pterin-4-alpha-carbinolamine dehydratase 474 150 textmining:407

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ferredoxin FdxC
  • MTBC0 PGAP product: ferredoxin family protein
  • Pfam (hmmscan --cut_ga): Fer4 PF00037.33 (E=2e-08)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215693.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Fer4 (PF00037.33)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1146
  • Curated reference: UniProt O50433 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 22 functional partner(s); context anchor dapC
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001266|Rv1177|fdxC
MTYTIAEPCVDIKDKACIEECPVDCIYEGARMLYIHPDECVDCGACEPVCPVEAIFYEDDVPEQWSHYTQINADFFAELGSPGGAAKVGMTENDPQAVKDLAPQSEDA